KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2305Help
Entry
Hden_2305         CDS       T01265                                 

Definition
adenosylhomocysteinase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hdn00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2354562..2355971
Genome map
AA seq 469 aa AA seqDB search
MSSKFTDYIVKDLSLAEWGRKEIAIAETEMPGLMATREEYGTSKPLKGARIAGSLHMTIQ
TAVLIETLAALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAWKGESLVEYWDYTRKLFE
WGDGGVPNMILDDGGDATLFIHLGLRAETGDTGFLDKAGSEEEEVLFALIKKTLKEKPKG
WFATVATNIKGVSEETTTGVHRLYEMQKNGTLLFPAINVNDSVTKSKFDNLYGCRESLVD
GIRRGTDVMMAGKIAMVAGFGDVGKGSAASLRNAGCRVMVSEIDPICALQAAMEGYEVVT
MEDAAPRADIFVTATGNKDIITVDHMRAMKDRAIVCNIGHFDNEIQIAGLKNFKWNNIKP
QVDEIEFPTGRRIILLSEGRLVNLGNAMGHPSFVMSASFTNQTLAQIELFTNHGKYHKEV
YTLPKHLDEKVAMLHLSKIGVNLTKLRPDQAAYIGVKTEGPFKPDHYRY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgaagttcacggactacatcgtcaaggatttgagcctggcggagtggggccgc
aaggaaatcgcgatcgccgagacggaaatgcccggcctcatggcgacgcgcgaggaatac
ggcacctcgaagccgctcaagggcgctcgcatcgcgggctcgctccacatgacgattcag
accgcggtgctgatcgagacgctcgcggccctcggcgccgacgtccgctgggtgtcgtgc
aacatctattcgacccaggatcatgcggccgccgcgatcgcggccgccggcatcccggtc
ttcgcctggaaaggcgaaagcctcgtcgaatactgggattacacgcgcaagctctttgag
tggggcgacggcggcgtaccaaacatgatcctcgacgacggcggcgacgcgacgctgttc
atccacctcggactccgcgccgagaccggcgataccggcttcctcgacaaggcgggctcg
gaagaagaagaggttcttttcgcgctcatcaagaagacgctgaaagagaagcccaagggc
tggttcgcgaccgttgcaaccaacatcaagggcgtttcggaagaaacgacgacgggcgtg
caccgtctctacgaaatgcagaagaacggcacgctgctgttcccggcgatcaacgtcaac
gacagcgtcaccaagtcgaaattcgacaacctctatggctgccgtgaaagcctcgtcgac
ggcatccgtcgcggcaccgacgtcatgatggccggcaagatcgccatggttgcgggtttc
ggcgacgtcggcaaaggctcggccgcgtcactgcgcaacgccggctgccgcgtcatggtc
tccgagatcgacccgatctgcgccctgcaggcggcgatggaaggctatgaagtcgtgacg
atggaagacgccgcgccgcgcgccgacatcttcgtcaccgcgacgggcaacaaggacatc
atcacggtcgaccacatgcgggcgatgaaagaccgcgcgatcgtctgcaacatcggccac
ttcgacaacgagatccagatcgccggtctcaaaaacttcaagtggaacaacatcaagccg
caggtcgacgaaatcgagttcccgacgggccgccgcatcatcctcctgtccgagggacgg
ctggtgaacctcggcaatgcgatggggcatccctcgttcgtcatgtcggcgtcgttcacg
aaccagacgctggcgcagatcgagctgttcacgaaccacggcaagtaccacaaggaagtc
tatacgttgccgaagcacctcgacgagaaggtcgcgatgctgcacctgtcgaagatcggt
gtgaacctcaccaagctgcgtcctgatcaggccgcctatatcggcgtcaagacggaaggc
ccgttcaagcccgatcactaccgctattga

DBGET integrated database retrieval system