KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2318Help
Entry
Hden_2318         CDS       T01265                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hden_2318
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hden_2318
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hden_2318
Enzymes [BR:hdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hden_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2374356..2375186)
Genome map
AA seq 276 aa AA seqDB search
MMTQPTRIDARFAALKTEKRPALITFVTAGDPDLETSKSILAGLANAGADVIELGMPFSD
PMADGPAIQASSQRALKAGQTMVKTLQMVRDFRAKDDATPIVLMGYYNPIYVYGNERFIA
DAKAAGVDGLIVVDVPPEADEELCLPALQAGLNFIRLATPTTDKRRLPTVLQNTSGFVYY
VSITGITGAAAPVVNDVQKQVAAIKSATPLPVVVGFGVRSGDQARALGQTADGVVVGSAI
VSRIEKSLGAKGEATPRTTEDVLELVKELSSAIRGG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccaacccactcgcatcgacgcgcgcttcgcggcgctgaagacagagaagcgc
ccggctctgatcaccttcgtcacggcgggcgatcccgatctcgaaacgagcaagtccatc
ctcgcggggctcgcgaacgcgggcgccgatgtcatcgagctcggcatgccgttctccgat
ccgatggcggacggaccggcgattcaggcgtcctcgcaacgcgcgttgaaggccggccag
acgatggtcaagacgctgcagatggtgcgcgatttccgcgccaaagatgatgcgaccccc
atcgtattgatgggctactacaaccccatttacgtttacgggaatgaacgcttcatcgcc
gacgcgaaggctgcgggcgtcgatggcttgatcgtcgtcgacgtgccgccggaagcggac
gaggagctttgcctgcccgcgctgcaggccggtctgaattttatccgcctcgcgaccccg
acgaccgacaagcgccgcttgcccaccgtcctccagaatacgtccggttttgtgtattat
gtctcgattacgggtattaccggcgcagcggcccctgtcgtaaacgacgttcagaaacag
gtcgccgcgatcaaaagcgccacgccgctgcctgtggttgtaggatttggcgtcagatcc
ggcgatcaggcacgcgccctgggacaaaccgccgatggcgtcgtcgttggctcggcgatc
gtatcaagaatcgaaaaatccctgggggcaaagggcgaagccaccccccggacgaccgaa
gatgtgctggaactggtgaaagagttaagctcagccatacgcggcggctag

DBGET integrated database retrieval system