KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2319Help
Entry
Hden_2319         CDS       T01265                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00260  Glycine, serine and threonine metabolism
hdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01130  Biosynthesis of antibiotics
hdn01230  Biosynthesis of amino acids
Module
hdn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hden_2319
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hden_2319
Enzymes [BR:hdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hden_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADJ24116
JGI: Hden_2319
UniProt: D8JRP8
Position
complement(2375187..2376428)
Genome map
AA seq 413 aa AA seqDB search
MATTQKKAEEAKLNSYATGPDDKGFFGIFGGRFVAETLMPLILDLERAYDAAKADPEFQR
EIDFLNRHYGGRPSPLYHAERLSAELGGAKIYFKREELNHTGSHKINNCLGQILLARRMG
KTRIIAETGAGQHGVAVATVCAKYGMPCEIYMGATDVERQAPNVARMALLGAKLNPVTSG
AGTLKDAMNEALRDWVTNVRDTYYLIGTAAGPHPYPAMVRDFQAIIGNEVRAQMLEAEGR
LPDTIVACIGGGSNAIGIFHPFLDDKDVAIYGVEAGGHGLNVVNGHAASMNGGSPGVLHG
NRTYLLQDGDGQILEGHSISAGLDYPGVGPEHAWLKDIGRVTYVPATDTEALDALRICTQ
LEGIIPALESSHALAYVMKLAPTLPKDNLLVVNISGRGDKDLATVAKHLGMKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgcaaaagaaggccgaggaagcgaagctcaacagctacgcgaccggcccg
gacgacaaaggcttcttcggtattttcggcggccgcttcgtcgctgaaaccttgatgccg
ctgatcctcgatctcgagcgcgcctacgacgccgcgaaggccgaccccgagtttcagcgc
gaaatcgattttctcaatcgccattacggcggccgcccgagcccgctctatcacgccgag
cgtttgagcgccgagcttggcggcgcaaagatctatttcaagcgcgaagagctgaaccac
acgggctcgcacaagatcaacaactgcctcgggcaaatcctgctcgcgcggcgcatgggc
aagacgcgtatcattgccgagacgggagccgggcagcacggcgtcgccgtcgcgaccgtc
tgcgccaagtacggcatgccgtgcgaaatctacatgggcgcgaccgacgtcgagcgtcag
gcgccgaacgtcgcgcgcatggcgttgctcggcgcgaagctcaacccggtgacgtccggc
gcgggtacgctcaaggacgcgatgaacgaagccttgcgcgactgggtgacgaacgtccgc
gacacttattatctgatcggcaccgcagccggcccgcatccttatccggcaatggttcgc
gactttcaggcgatcatcggcaacgaggttcgcgcgcagatgctcgaagcggaaggacgc
ttgccggacacgatcgttgcgtgcatcggcggcggctcgaacgcgatcggaattttccat
cctttcctcgacgacaaggacgtcgcgatttacggcgtcgaagccggcggtcacggcttg
aacgtcgtgaacggtcacgccgcgtcgatgaacggcggatcaccgggcgttctgcacgga
aaccgcacctaccttttgcaggatggcgacgggcagattctcgaaggccattcgatttcg
gccggacttgattacccgggcgtcggaccggagcacgcctggctgaaggatatcggccgc
gtgacctacgttcccgcaaccgacacggaagcactcgacgcgcttcggatttgcacgcag
ctcgaaggcatcattccggcgctggagtcgagccacgcattggcctacgtgatgaagctc
gcgccgacgttgccaaaagacaatctgctggttgtcaacatttcgggccgtggcgacaag
gacctggccaccgtcgccaaacatctcggcatgaagatctga

DBGET integrated database retrieval system