KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2415Help
Entry
Hden_2415         CDS       T01265                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hden_2415
Enzymes [BR:hdn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Hden_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2475623..2476726)
Genome map
AA seq 367 aa AA seqDB search
MKRSIYLQPTAIFWDRSRRRAIDEPDIPEWRGLPLAGGRLSFAALDVLTRATPETKRRTI
VLGDAFSGDWGREALAAADILEELSTQRPRIAGLSLDRPRIMGIVNVTPDSFSDGGENLD
AEKAIAHGLQLVAEGADILDIGGESTRPQSDAVALDEELRRVLPVIEGLRARTDAVISID
TRKAEVMRRAAAAGADILNDVSAFTHDPDSLAVAAETELPVVIMHAQGDPKTMNDNPQYD
DVVLDVFDYLESRVQACVAAGIPKSKIVVDPGIGFGKHLHHNVAVMAGLSLYHGLGVPIL
LGASRKKMIGQLCNVDDAKDRVSGSLATAIAGVGSGVQIVRVHDVKETKQAIEVWRACTA
GTEKGLD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctcgatttacctccagccgactgcgatcttctgggacaggagccgacgccgc
gccatcgacgagcccgatatcccggaatggcgcggattgccgctcgcaggcgggcgcttg
tcgttcgccgcgctggatgtcttgacgcgcgcgacgccggaaacgaagcggcgcacgatc
gtcctcggcgatgcgttcagcggcgactggggccgcgaggctctggcggcagccgacatc
ctcgaggaactatccacgcagcgtccacgcatcgccggattgtcgctcgaccggccccgc
atcatgggcatcgtcaacgtcacgccggacagcttctccgacggcggcgaaaacctcgac
gccgagaaggcaatcgcgcacggtcttcagctcgtcgccgaaggcgccgacatcctcgat
atcggcggcgagagcacgcgcccgcagtcggacgctgttgcactcgacgaggaactgcgt
cgcgtcctcccggtcatcgaaggcctgcgcgcccgcaccgacgccgtgatctcaatcgat
acgcgcaaggccgaggtgatgcgccgcgccgccgctgccggggccgacattctgaatgac
gtctcggcgttcacgcatgatccggactcgctcgccgtcgcggctgaaaccgagctgccc
gtcgtcatcatgcacgcgcagggcgatccgaaaacgatgaacgacaatccgcagtatgac
gatgtcgtcctcgacgtattcgattacctcgaaagccgcgtgcaggcctgtgtcgccgcc
ggaatcccgaaatcgaaaatcgtcgttgatcccggcatcggcttcggcaagcaccttcat
cacaacgtcgcggtgatggcggggctgtcgctctatcacggtctcggcgtgccgatcctt
ctcggtgcgagccgcaagaaaatgatcggccagctctgcaacgtcgatgacgcgaaggat
cgcgtgtcgggatcgctggcgacggccatcgcgggtgtcggatcgggcgtgcagatcgtg
cgcgttcacgacgtcaaggaaacgaagcaggcgatcgaggtctggcgcgcctgtacggcg
ggcaccgaaaaggggttggattaa

DBGET integrated database retrieval system