KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2519Help
Entry
Hden_2519         CDS       T01265                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hden_2519
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Hden_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2573522..2574196)
Genome map
AA seq 224 aa AA seqDB search
MSKGKSRRPSEKSLRKAVLDTALAMSSSGLSPGRSGNVSCRFDDGMLITPSGVRYDDIDP
DDIVFVSADGSVPDDRQTPSTEWHFHLAAYRARPDRFAVVHTHSMHATVLACAHRAIPAF
HYMVGVAGGKDIPCVPYATFGTAELARHVATGLQDRDACLMANHGQIAIGPTLGHALELA
AEVEALAEQYYKVLTLGPANILNDDEMALLLDKFKTYGRNVAEK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggcaagtccaggcgtccgagtgaaaaaagcctgaggaaggctgtgctcgac
acggcgctcgcgatgagctcttccggcctttcgccaggacgatccggaaacgtatcctgc
cgcttcgacgacggcatgctgatcacaccatccggcgtgcgttatgacgacatagatccc
gacgacatcgttttcgtttcagccgacggcagcgttcccgacgatcgccagacgccgtcg
accgaatggcattttcatctggccgcctatcgcgcgcgtcccgatcgcttcgccgtcgtc
cacacgcactcgatgcacgcgacggttctcgcctgcgcgcaccgcgcgatcccggcattt
cactacatggtcggcgtcgcgggcgggaaggacatcccgtgcgtgccttacgccaccttc
ggcaccgcggagctggcgcgtcacgtcgcgaccggattgcaagaccgcgacgcgtgcctg
atggcgaaccacggacagatcgcgatcggcccgacgctcggtcatgcgctggagcttgcc
gccgaagtcgaggcacttgctgagcaatactacaaggtgctgaccctcggccccgcgaac
atcttgaacgacgacgagatggcgctgctgctcgacaagttcaaaacctacggccgcaac
gtcgccgaaaagtaa

DBGET integrated database retrieval system