KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2650Help
Entry
Hden_2650         CDS       T01265                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hdn00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2713699..2714667)
Genome map
AA seq 322 aa AA seqDB search
MKLVSLSINPVPSGATVSEFDGYDGLKLRYALWEPTRGPVRGTVCIVQGRGEFIEKYFEV
IADLRRRGFAVATFDLRGQGGSERLLSNPRKGHVLAFTEYDRDLAIFIDEIVKPALPQPL
IGLGHSLGGNILLRNAQDEASPFARMVLMAPMIAIHENMLGVSPGIARAYANIACLFGFA
GTYVRGGGDEPDDFKDFETNRLTSDHVRWSRNKAIIEAAPELATGSPTVGWLRAALRSTA
MLLRPEYPKYVCVPMILFAAGADKVVSTQAIEDFAVDLKFGAHILMPGSRHEILQETDAV
RQRFWAAFDAYMGITTASPEKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtatcactctcgatcaatccagtgccgagcggcgcgacggtttccgagttc
gacggctacgacggcctcaagctgcgttacgcgctgtgggagccgacgcggggtccggtg
cgcggcaccgtctgcatcgtgcaagggcgcggcgaattcatcgaaaaatatttcgaggtc
atcgctgatcttcgccgccgcggctttgccgtcgcgaccttcgatcttcgcggccagggc
ggctccgagcggctgctgtcgaacccgcgcaaaggccatgtgctcgccttcaccgaatac
gatcgcgacctcgcgatcttcatcgacgaaatcgtcaagccggcgctgccgcagccgctg
atcgggctcggtcattcgctcggcggcaatatcctgcttcgcaacgcccaggacgaggcg
agtccgttcgcccgcatggttctgatggcgccgatgatcgcgatccacgaaaatatgctc
ggcgtcagccccggcatcgcgcgcgcctacgcgaatatcgcatgtcttttcgggttcgcc
gggacgtatgtccgaggcggcggcgacgagccggacgacttcaaggatttcgaaacgaac
cgcctgacgtcggaccatgtgcgctggtcgcgcaacaaggcgatcatcgaagccgcgccg
gaactcgcgaccggctcgccgacggtcggctggctgagagccgcgctccgaagcacggcg
atgctgcttcggcccgaatatccgaagtatgtgtgcgtcccgatgatcctgttcgcggcc
ggggccgacaaggtcgtctcgacccaggcgatcgaagatttcgccgtcgatctgaagttc
ggcgcgcacatcctgatgccgggatcgcgtcacgagatcctgcaggaaaccgacgccgtg
cggcagcgcttctgggcggccttcgacgcctacatgggaattaccacggcgtcgccggag
aaggcctag

DBGET integrated database retrieval system