KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2650Help
Entry
Hden_2650         CDS       T01265                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hden_2650
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Hden_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2713699..2714667)
Genome map
AA seq 322 aa AA seqDB search
MKLVSLSINPVPSGATVSEFDGYDGLKLRYALWEPTRGPVRGTVCIVQGRGEFIEKYFEV
IADLRRRGFAVATFDLRGQGGSERLLSNPRKGHVLAFTEYDRDLAIFIDEIVKPALPQPL
IGLGHSLGGNILLRNAQDEASPFARMVLMAPMIAIHENMLGVSPGIARAYANIACLFGFA
GTYVRGGGDEPDDFKDFETNRLTSDHVRWSRNKAIIEAAPELATGSPTVGWLRAALRSTA
MLLRPEYPKYVCVPMILFAAGADKVVSTQAIEDFAVDLKFGAHILMPGSRHEILQETDAV
RQRFWAAFDAYMGITTASPEKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtatcactctcgatcaatccagtgccgagcggcgcgacggtttccgagttc
gacggctacgacggcctcaagctgcgttacgcgctgtgggagccgacgcggggtccggtg
cgcggcaccgtctgcatcgtgcaagggcgcggcgaattcatcgaaaaatatttcgaggtc
atcgctgatcttcgccgccgcggctttgccgtcgcgaccttcgatcttcgcggccagggc
ggctccgagcggctgctgtcgaacccgcgcaaaggccatgtgctcgccttcaccgaatac
gatcgcgacctcgcgatcttcatcgacgaaatcgtcaagccggcgctgccgcagccgctg
atcgggctcggtcattcgctcggcggcaatatcctgcttcgcaacgcccaggacgaggcg
agtccgttcgcccgcatggttctgatggcgccgatgatcgcgatccacgaaaatatgctc
ggcgtcagccccggcatcgcgcgcgcctacgcgaatatcgcatgtcttttcgggttcgcc
gggacgtatgtccgaggcggcggcgacgagccggacgacttcaaggatttcgaaacgaac
cgcctgacgtcggaccatgtgcgctggtcgcgcaacaaggcgatcatcgaagccgcgccg
gaactcgcgaccggctcgccgacggtcggctggctgagagccgcgctccgaagcacggcg
atgctgcttcggcccgaatatccgaagtatgtgtgcgtcccgatgatcctgttcgcggcc
ggggccgacaaggtcgtctcgacccaggcgatcgaagatttcgccgtcgatctgaagttc
ggcgcgcacatcctgatgccgggatcgcgtcacgagatcctgcaggaaaccgacgccgtg
cggcagcgcttctgggcggccttcgacgcctacatgggaattaccacggcgtcgccggag
aaggcctag

DBGET integrated database retrieval system