KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2657Help
Entry
Hden_2657         CDS       T01265                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hden_2657
   00052 Galactose metabolism
    Hden_2657
   00500 Starch and sucrose metabolism
    Hden_2657
   00520 Amino sugar and nucleotide sugar metabolism
    Hden_2657
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hden_2657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2726038..2726931
Genome map
AA seq 297 aa AA seqDB search
MNAAIRPIRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVLQHVVDEARAAGIEHFIFV
TGRNKAVIEDHFDNQFELEATLASRNKTKELEALARDLPAAGQTSFTRQQAPLGLGHAVW
CAREIVGNEPFALLLPDMIHHGRTSCLADMIAAYNKHGGNLVAVAPVPEDQTHQYGIVGV
KDAKADVSTITGMVEKPKPGTAPSNLHITGRYILQPDIFSLLEKQERGAGGEIQLTDSMI
RLMQDGKQPFHAVRFNGTIYDCGSKLGFLTANVALALEREELAGDFKREVQRLLDGA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgcgatcaggcccattcgcaaagccgtgtttcccgtcgcaggactggggacg
cgttttcttccggcaacgaaggccgtaccgaaggaaatgctgacggtcgtcgaccggccg
gtgctgcagcacgtcgtcgacgaagcgcgcgccgcgggtatcgagcacttcatcttcgtc
accgggcgcaacaaggccgtgatcgaagatcacttcgacaatcagttcgaactcgaagca
acgctggcgtcgcggaacaagacgaaagagctcgaggctctggcgcgcgatcttcccgct
gcagggcagacgagctttacgcgccagcaagcgccgttggggctcggccacgccgtctgg
tgcgcgcgcgagatcgtcggcaatgaaccgttcgctctcttgcttcccgacatgatccat
cacggccggacgtcgtgtctcgcggacatgatagcggcttacaacaagcatggcggcaat
ctcgtcgccgtcgcgccggtgcccgaggatcagacgcatcagtacgggatcgtcggcgtg
aaggacgctaaggccgacgtttccacgattaccggaatggtcgagaagccgaagcccgga
acggcgccgtccaatcttcacatcacgggacgctatattctgcagcccgacattttctcg
ctgctggagaagcaggagcgcggcgcgggcggcgaaattcagctcaccgactccatgatc
cggctgatgcaggacggcaagcagccgttccacgccgtgcgcttcaacggcacgatttac
gactgcggttcgaagctcggattcctgaccgcgaacgtggcgttggcgctggagcgcgag
gagcttgcgggcgacttcaagcgcgaggttcagcggttgctcgacggagcttag

DBGET integrated database retrieval system