KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2727Help
Entry
Hden_2727         CDS       T01265                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hdn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2803556..2804161)
Genome map
AA seq 201 aa AA seqDB search
MSRKIAGPEIERLVQLLSRLPGLGPRSARKAVLSLLKRRNDLLLPLSDALQQAVEKISEC
PVCGNLDTVSPCSVCSDPRRDQSLIVVVEEVGDLWALERANIVSARYHVLGGHLSPLDGI
GPEQLNVANLLARAAASEVKEILLALNATVEGQSTAHYISDQLAATDVTVSRLAQGVPIG
GELDYLDDGTLAAAFKARRKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaaaatcgcaggacctgaaatcgagcgcctcgtgcagctcctgtcgcgcttg
ccggggcttggaccgcgctcggcgcgcaaggcggtgctgtcgcttctgaagcggcgcaac
gatttgctgctgccgttgtcggacgcgctccagcaggccgtcgaaaaaatttccgaatgc
cccgtctgcggcaatctcgatacggtttcgccgtgcagcgtctgcagcgatccgcgccgc
gatcaaagcctcatcgtcgttgtcgaagaagtcggcgacctctgggcgctcgagcgcgcg
aacatcgtctcggcgcgctatcatgtgctcggcggccacctgtcgccgctcgacggcatc
gggccggagcagctcaacgtcgccaatcttttggcgagagctgcagcctccgaagtcaaa
gagatcctgctcgctctcaacgccaccgtcgaaggccagtcgaccgcccattacatttcc
gatcaactcgccgcgaccgatgtgacggtctcgcgacttgcgcaaggcgtcccgattggc
ggcgaactcgattatctcgacgacggcacgctcgctgcggctttcaaagcgcggcgcaag
ctgtag

DBGET integrated database retrieval system