KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2727Help
Entry
Hden_2727         CDS       T01265                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hden_2727
DNA repair and recombination proteins [BR:hdn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hden_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2803556..2804161)
Genome map
AA seq 201 aa AA seqDB search
MSRKIAGPEIERLVQLLSRLPGLGPRSARKAVLSLLKRRNDLLLPLSDALQQAVEKISEC
PVCGNLDTVSPCSVCSDPRRDQSLIVVVEEVGDLWALERANIVSARYHVLGGHLSPLDGI
GPEQLNVANLLARAAASEVKEILLALNATVEGQSTAHYISDQLAATDVTVSRLAQGVPIG
GELDYLDDGTLAAAFKARRKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaaaatcgcaggacctgaaatcgagcgcctcgtgcagctcctgtcgcgcttg
ccggggcttggaccgcgctcggcgcgcaaggcggtgctgtcgcttctgaagcggcgcaac
gatttgctgctgccgttgtcggacgcgctccagcaggccgtcgaaaaaatttccgaatgc
cccgtctgcggcaatctcgatacggtttcgccgtgcagcgtctgcagcgatccgcgccgc
gatcaaagcctcatcgtcgttgtcgaagaagtcggcgacctctgggcgctcgagcgcgcg
aacatcgtctcggcgcgctatcatgtgctcggcggccacctgtcgccgctcgacggcatc
gggccggagcagctcaacgtcgccaatcttttggcgagagctgcagcctccgaagtcaaa
gagatcctgctcgctctcaacgccaccgtcgaaggccagtcgaccgcccattacatttcc
gatcaactcgccgcgaccgatgtgacggtctcgcgacttgcgcaaggcgtcccgattggc
ggcgaactcgattatctcgacgacggcacgctcgctgcggctttcaaagcgcggcgcaag
ctgtag

DBGET integrated database retrieval system