KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2733Help
Entry
Hden_2733         CDS       T01265                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hden_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADJ24529
JGI: Hden_2733
UniProt: D8JTY1
Position
2809698..2810267
Genome map
AA seq 189 aa AA seqDB search
MRIDEFEFTKIAGAILSALLLIFGTKTIIEMNVGHGAFKPGFTLPAPSEGGGAEAPGGAA
PAAAETPEEAAKKIVALLPKANAENGKATFKKCASCHVAEKDKKATVGPNLWDVVNRKRA
SFPGFAYSDAMKAKGGEWSFEELAKFIHSPKTYIPGTKMVFAGLSSDTDEADLLAYLATL
ADTPVPLPK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgacgaattcgagttcaccaagatcgccggtgcgattctttccgcgctgctg
ctgatcttcgggacgaagacaatcatcgagatgaacgtcggccatggcgcgttcaagccg
ggctttacgcttccggctccgagcgagggcggtggtgccgaagcgccaggtggcgcggcg
ccggctgcagccgaaacgcctgaagaagccgcgaaaaagatcgtcgcgctgcttcccaaa
gccaacgccgagaacggtaaggcgaccttcaagaagtgcgcatcctgccacgttgccgaa
aaggacaagaaagcgaccgtcggcccgaacctttgggatgtggtcaatcgtaaacgggcg
tcattcccaggcttcgcctattcggatgctatgaaggccaagggcggcgagtggtcgttc
gaggaactggcgaaattcatccacagcccgaaaacctacattccgggaacgaaaatggtt
ttcgcgggcctctcgtctgataccgacgaagcggatctgctcgcttatctggcaacgctt
gccgatacgcccgttcccttgccaaaatga

DBGET integrated database retrieval system