KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2771Help
Entry
Hden_2771         CDS       T01265                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00071  Fatty acid degradation
hdn00072  Synthesis and degradation of ketone bodies
hdn00280  Valine, leucine and isoleucine degradation
hdn00310  Lysine degradation
hdn00362  Benzoate degradation
hdn00380  Tryptophan metabolism
hdn00620  Pyruvate metabolism
hdn00630  Glyoxylate and dicarboxylate metabolism
hdn00640  Propanoate metabolism
hdn00650  Butanoate metabolism
hdn00900  Terpenoid backbone biosynthesis
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
hdn01212  Fatty acid metabolism
hdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hden_2771
   00630 Glyoxylate and dicarboxylate metabolism
    Hden_2771
   00640 Propanoate metabolism
    Hden_2771
   00650 Butanoate metabolism
    Hden_2771
  Lipid metabolism
   00071 Fatty acid degradation
    Hden_2771
   00072 Synthesis and degradation of ketone bodies
    Hden_2771
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hden_2771
   00310 Lysine degradation
    Hden_2771
   00380 Tryptophan metabolism
    Hden_2771
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hden_2771
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hden_2771
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hden_2771
Enzymes [BR:hdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hden_2771
Exosome [BR:hdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hden_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Robl_LC7 7TMR-HDED ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADJ24567
JGI: Hden_2771
UniProt: D8JU19
Position
complement(2854014..2855204)
Genome map
AA seq 396 aa AA seqDB search
MSEDSSTIVIASAARTPVGSFNGALASLPASKLGEIAIKAALKRANIQPGDVSEVILGQV
LTAAQGQGPARQASVGAGVPVDSPAWSINQICGSGLRAVALGMQQIKTGDAKIVVAGGQE
SMSQSAHAGHMRDGTKMGDFKLIDTMVKDGLWDAFNNYHMGTTAENVARQWQITREDQDK
FAVASQNKAEAARKAGKFKDEITPVTIKTKKGETVVDQDEYIKEGVTIDSIAKLRPAFDP
KEGTVTAANASGINDGAAVVVLMTAEEAKKRGIKPLARIVSWATTGVDPSIMGTGPISAS
KKALEKAGWTIADLDLIEANEAFAAQALAVNKGLGWDTEKVNVNGGAIAIGHPIGASGAR
ILNTLLFEMQRRDAKKGLATLCIGGGMGVALCVARD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagattcttcgacgattgtgattgcaagcgcagcccgcacgccagtcggttcg
ttcaacggcgcgctcgcatcgttgccggcttccaagctcggcgaaatcgcgatcaaggcc
gccctcaagcgcgccaatattcagcccggcgacgtttccgaggtcatcctcggtcaggtt
ctgacggccgctcagggtcaaggccccgcgcgtcaggcatccgtcggcgcgggcgtgccg
gtggattctcccgcttggagcatcaatcagatttgcggttcgggcttgcgcgccgtcgcg
ctcggcatgcagcagatcaagaccggagacgcgaagatcgtcgtcgccggcggccaggaa
agcatgagccagtcggcacacgccggacacatgcgcgatggtaccaagatgggcgacttc
aagctcatcgacacgatggtgaaggacggcctctgggacgccttcaacaactaccacatg
ggcacgacggccgagaacgtcgcgcgccagtggcagatcacgcgcgaagatcaggacaag
ttcgccgtcgcttcgcagaacaaagccgaagccgcacgcaaggctggcaagttcaaggac
gagatcacgcccgtcacgatcaagacgaagaagggcgagaccgtcgtcgatcaggacgag
tacatcaaggaaggcgtgaccatcgatagcatcgcgaagctgcgccccgccttcgatccg
aaggaaggcacggttacggccgcgaacgcatcgggcatcaatgacggtgcagccgtcgtc
gttctgatgaccgccgaagaagccaagaagcgcgggatcaagccgcttgcccgcatcgtg
tcgtgggccacgaccggcgtcgatccgtcgatcatgggcacgggcccgatctcggcttct
aagaaggcgctcgaaaaagccggctggacgatcgccgatctcgatctcatcgaagccaac
gaagcgttcgccgcgcaggcgctcgccgtcaacaaaggcctcggctgggatacggagaag
gtcaacgtcaacggcggcgcgattgccatcggtcatccgatcggcgcttccggcgcgcgc
atcctcaacacgcttctgttcgaaatgcagcgccgcgatgcgaagaagggccttgccacg
ctttgcatcggtggcggcatgggcgtcgccctgtgcgtcgctcgcgactga

DBGET integrated database retrieval system