KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2869Help
Entry
Hden_2869         CDS       T01265                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00900  Terpenoid backbone biosynthesis
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01130  Biosynthesis of antibiotics
Module
hdn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hden_2869
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Hden_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADJ24665
JGI: Hden_2869
UniProt: D8JUN5
Position
complement(2960222..2961088)
Genome map
AA seq 288 aa AA seqDB search
MPKSEFAPAKINLTLEILGRRADGYHELRSLVAFAHDAGDVVTLAPGSSASVETSGSFAG
DISGSNLVDKAISAFAAKVPGMKPPRLILDKNLPVASGIGGGSADAAATLRLLSKSYPGI
ADRDLHTIARALGADVPVCVRARPVIMTGVGETLEEIALPQEVYAVLVNPLIAVPSNKTA
HVFAALGAAPLTAPPEAEPAPRLSNVRDVIAYAKARGNDLQAPAQKLFPEIETVLAELHR
TEGALFAQLSGAGPTCFALFATKQEAVAGASALRQRQPNWWIRPTRLG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtctgaattcgctcccgccaagatcaatctcacgctggaaattctcgggcgg
cgtgccgacggttatcatgagcttcgcagtctcgtcgcgttcgcgcacgacgccggcgac
gtggtcacgctcgcgccgggatcatccgcgagcgtcgaaacgtcgggatcgttcgcaggc
gacatctccggcagcaatcttgtcgacaaagccatctcggcgttcgccgcgaaggtgccg
ggcatgaagccgccccggctgatactggacaaaaatcttccggtggcgagtggcatcggc
gggggctcggccgacgcggccgcgacgcttcggttactctccaaatcttatccaggaata
gccgatcgcgatcttcacacgatcgcgcgtgcgctgggcgcggacgttcccgtttgcgtc
agagcgcggcccgtcatcatgaccggcgtcggcgaaacgctcgaagaaatcgcgttgccg
caagaagtttatgccgtgctcgtcaatccgcttattgccgtgccctcgaataagacagct
cacgtcttcgcagccctgggcgcggcgccactcaccgctccgcctgaagccgaaccggcg
ccccgcctgtcaaacgtgcgtgacgtcatcgcctacgccaaggcgcgaggtaacgacctg
caagcgcctgcgcaaaaactgtttccggagatcgagaccgtgctcgccgagcttcatcgc
accgaaggcgctttgttcgctcagctttccggtgcaggcccgacgtgcttcgcgctgttc
gcaacgaagcaggaagccgttgccggagcgtcggcgctccggcaacggcagcccaattgg
tggatcaggccgacacgacttggctaa

DBGET integrated database retrieval system