KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2900Help
Entry
Hden_2900         CDS       T01265                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hden_2900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hden_2900
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hden_2900
Enzymes [BR:hdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hden_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2992457..2993857)
Genome map
AA seq 466 aa AA seqDB search
MKYISTRGGAEALGFEDVLLAGLARDGGLYVPEVWPTLTPDTIASFRDKPFVEIAVEVIH
PFTGDEISRDELRRMASEAYATFDTSEVTPLVEIKPGLTILELFHGPTLAFKDVAMQLLA
RLMDHVLEKRGARATIVGATSGDTGGAAIEAFRSSKRVDVVILFPKGRVSDVQRRMMTTP
TEPNVHAVAIEGTFDDCQALVKAMFNDHAFRDRVELSGVNSINWARIVAQVTYYFWAASR
IGTTEPLSFSVPTGNFGDIFASYVAKRLGLPIDKLIIASNENDILPRAVATGVYAMKDVI
ATSSPSMDIQISSNFERYLFEASDRDADFVRSSMTSLIATGSFELGRTGSRLKQDFAAVS
ASEADVADAIRRTKTAYGYVLDPHTACAFVAAERVAPAGNTVILSTAHPAKFPDAIEAIT
GARPALPAHQAHLMTDAEKFDTLPNSLSSVQKFVLKHCRVAAGTPQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacatttctactcggggcggggcggaagcgctcgggttcgaagatgtcctgctt
gccggattggcgcgcgacggcggtctgtacgtccccgaagtctggccgacgctgacgcct
gacacgatcgcgtcgtttcgcgacaagccgttcgtcgaaatcgctgtcgaggtcatccat
ccttttaccggcgacgagatctcgcgcgatgaactgcgccgcatggcgtcggaagcctac
gcgaccttcgatacgtccgaggtgacgccgctcgtcgaaatcaaacccggcctgaccatc
ctcgaattgttccacggcccgacgctcgccttcaaagacgttgcgatgcaactcctggcg
cggctgatggatcacgtgctcgagaagcgcggcgctcgcgccaccatcgtcggcgcgacg
tcgggcgataccggcggcgcggccatcgaagccttccgctcgtcgaagcgcgtcgacgtc
gtgatcctgtttcccaaaggccgcgtgtccgacgttcaacgccgcatgatgacgacgccg
acggaaccgaacgtccatgccgtcgcgatcgaaggcacgttcgacgactgtcaggcgctc
gtcaaagcgatgttcaacgatcacgcgtttcgggatcgcgtcgagctgtccggcgtcaat
tcgatcaactgggcccgcatcgtcgcgcaggtcacttactatttctgggcggcgtcgcgc
atcggaaccaccgagccgttatcgttttccgtaccgaccggaaacttcggcgacattttt
gcgagctacgtcgcaaagcgcctgggtctcccgatcgacaagctcatcatcgcctcgaac
gaaaacgatatcctgccgcgcgccgtcgcgacgggcgtctatgcgatgaaggacgtcatc
gccacgtcgtcgccctcgatggacattcagatctcgtcgaatttcgagcgctatctgttc
gaggcgtcggatcgtgacgccgattttgtccgcagctcgatgacatcgctgatcgccacc
gggagtttcgagcttggccgcacaggctcgcgcttgaagcaggatttcgccgctgtctcg
gcatcggaagccgacgtcgcggatgcgatccgccgcacgaaaaccgcatatggctatgtt
ctcgatccgcacacggcgtgcgcgttcgtagccgccgagcgtgtcgctccggcggggaac
accgtcattctctcgacggcgcaccctgcgaagtttccggacgcaatcgaagccattacc
ggtgcgcgcccggctttgcccgcgcatcaagcgcatctcatgaccgatgcagagaaattc
gatacgctgccgaacagtctctcgtcggtgcagaagttcgtcttgaagcattgccgcgtg
gcggccggaacccctcaatga

DBGET integrated database retrieval system