KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3113Help
Entry
Hden_3113         CDS       T01265                                 

Definition
(GenBank) glycoside hydrolase family 24
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Brite
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Hden_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme Calpain_inhib
Motif
Other DBs
NCBI-ProteinID: ADJ24908
JGI: Hden_3113
UniProt: D8JW29
Position
complement(3174730..3175440)
Genome map
AA seq 236 aa AA seqDB search
MLDQSYLDAIKKFEGFSAEARWDYAQNSNGYGTRARYAGEVIDKAEADRRFAGEIQKAAD
FVDRFAPGLDDGSRAALTSLTYNAGTAWTQSGLGDAVSNGDMNKARSLFLQYHKAGGEAL
DGLVQRRLQEVAWFGSGAPAAQSQSTSVVAMAQQPNSAPPMEIESPVAPQTAASHPRSVV
RLADSSSEPRSSSGRAFADLGSDPALLALLAHIGKSQPTREADDKRAEPRTEPQAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgctggaccagagctatcttgacgccattaaaaaattcgaaggcttttctgccgaagcc
cgctgggactacgcgcagaattcgaacggctatggcacgcgcgcgcgttacgcgggcgaa
gtcatcgacaaggcggaagccgatcgccgcttcgccggagagatccagaaagccgccgat
ttcgtcgatcggttcgcaccgggattggacgacggcagccgcgcggctctgacgtcgttg
acctacaacgcgggaacggcctggacgcagagcggcctcggtgacgccgtctcgaacggc
gacatgaacaaggcgcgctcgcttttcctacaatatcacaaggccggaggcgaagcgctc
gacggcctcgttcagcgccgtctgcaggaagtcgcctggttcggttcgggagcgccggcg
gcgcaatcgcaatcgacgtcggtcgtcgcgatggcgcaacagccgaactcggctccgccg
atggagatcgaaagccccgtcgcgccacagacggcagcatcacatccgagaagcgtcgtt
cgtctggccgacagcagttcggaaccgcgctcgtcgtcaggtcgcgccttcgccgatctg
ggtagcgatcccgcgttgctggcgctgctcgctcatatcggaaaaagccagccgacgcgc
gaggccgacgataagcgcgctgagcctcggaccgagccgcaagccgtctga

DBGET integrated database retrieval system