KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3226Help
Entry
Hden_3226         CDS       T01265                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hden_3226
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hden_3226
  Amino acid metabolism
   00310 Lysine degradation
    Hden_3226
Enzymes [BR:hdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hden_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3299370..3300704)
Genome map
AA seq 444 aa AA seqDB search
MSIEIRVPALGESVTEATVGKWFKQTGDAVNVDEPLVELETDKVTVEVPAPAAGVLGDIL
VKSGTTVAVGSLLAALKDGAAKSSAGNSQTTAPQAAKPSAPPSQPKPEHVAAKAPESAPA
ADAPRPPPAALKALTEAGLEPSDVRGTGRRGQILKEDVINAVAATAAKPAASPPPLREPT
AAPVSPNAVTIQEAPATIVMRDVRLPSPANDATREERVRMSKLRQTIARRLKEAQNAAAM
LTTFNDVDMSAIMALRAQYKDVFEKRHGVKLGFMGLFVKAAIQALRDVPSVNAEIDHDEI
VYKNYYHIGVAVGTEKGLVVPVVREADRLSLAEIEQKITEFGKRARDGKLSIEDMQGGTF
TISNGGVYGSLMSTPILNAPQSGILGMHRIEERPVVRNGQIVARPMMYLALSYDHRIVDG
KEAVTFLVRIKECLEDPQRFILEL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgagattcgcgttcccgcgcttggggaaagcgtcacggaggcgaccgttggc
aagtggttcaaacagaccggcgacgccgtgaatgtcgacgagccgctggtcgagctcgaa
accgacaaagtgaccgtcgaagttcccgctcccgcggccggcgtgctgggcgacattctc
gtcaagtcgggtacgacggtggcggtcggatctctgctcgcggccttgaaagatggcgcg
gcgaagtcatcggcaggcaattctcaaacgacggcgccccaggcggcaaagccgtccgcg
cccccttcgcagccgaagcccgagcatgtcgcagcgaaagctccggaaagcgctccagcg
gcagacgcccctcgcccgccgcccgccgccctcaaggcgctgacggaagctggcttggaa
ccctccgacgtgcgtggtaccggccgccgcgggcaaatcctgaaggaagacgtcatcaat
gccgttgcagccacggccgcaaaaccggcggcatctccgccgcctctgcgtgaaccaacg
gccgcgccggtctcgcccaacgcggtcaccattcaagaagcgccggcgacgattgtgatg
cgcgacgtgcgcctgccgtcacccgccaacgatgcgacgcgcgaagaacgcgtccggatg
tcgaagcttcgccagaccatcgcgcgccgcctgaaggaagcgcagaacgccgccgcaatg
ctgacgacgttcaacgacgtcgacatgagcgccatcatggcgctgcgcgcgcagtacaag
gatgtgttcgagaaacggcacggcgtgaagctcggcttcatgggcctgttcgtgaaggcc
gccattcaggcgctccgcgacgtgccctccgtcaacgccgagatcgatcacgacgagatc
gtttacaagaattactatcacatcggcgtcgcggtcgggacggagaagggcctcgtcgtg
ccggtcgtgcgcgaagccgaccgcctcagcctcgccgagatcgagcagaagatcaccgaa
ttcggcaagcgcgcccgcgacggcaaactgtcgatcgaggacatgcagggcggtacgttc
acgatctcgaacggcggcgtctacggctcgctgatgtcgacgccgatcctgaacgcgccg
caatccggtattctcggcatgcatcgcatcgaggaacgcccggtcgtccgcaacggccag
atcgttgcgcgcccgatgatgtatctcgcgctgtcctacgatcatcgcatcgtcgatggc
aaagaggcggtgacgttccttgtccgcatcaaggaatgtctcgaagatccgcagcgcttc
atcctggagctctga

DBGET integrated database retrieval system