KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3229Help
Entry
Hden_3229         CDS       T01265                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hden_3229
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hden_3229
   00640 Propanoate metabolism
    Hden_3229
   00660 C5-Branched dibasic acid metabolism
    Hden_3229
Enzymes [BR:hdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hden_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3305045..3306244)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELYRAYGVPTPNGFAAFSVAEAVEAAKKLPGPVWVVKAQIHAGGRGKGKFL
EASAGDKGGVRLAKSIDEVKEFAEQMLGKTLVTVQTGNAGRVVNRLYIEDGSAIDRELYL
SALVDRSTSRVAFIVSQAGGMNIEDVAHETPEKIHTLTIDPATGYQPFHGRKVAFALGLK
GDQVKAAGKLVENLYRMVVEKDMSLLEINPLVVTKDGKLICLDGKMNFDSNALYRHPEIV
ELRDLGEEDQTEIEASKHDLAFVKLDGNIGCLVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVREAFKIILADPSVKGILVNIFGGIMRCDIIAEGVIAAAREMDIKVPLVVRLE
GTNVDLGKKILKESGLKIIPADDLADAAKKITDELKQVA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggccaaagagctgtatcgcgcctatggcgtcccgacgccg
aacggtttcgcggcgttctcggtcgccgaagcggttgaagcggcgaagaaacttcccggg
ccggtgtgggtggtcaaagcgcaaattcatgccggaggccgcggcaaaggcaaattcctt
gaagcgtctgcaggcgacaaaggcggggttcgcctcgccaaatcgatcgacgaggtgaag
gaattcgccgagcagatgctgggtaaaacgctcgtcacggtccagaccggaaacgccggg
cgcgtcgtcaatcggctctatatcgaggacggctccgcgatcgatcgcgagctttatctc
tccgcgctcgtcgatcgttcgacgtcgcgtgtcgccttcatcgtcagccaggcgggcggc
atgaacatcgaagacgtcgcgcacgaaacgccggaaaaaattcacactctgacgatcgat
cccgccaccggctatcagccgtttcacggccgcaaggttgccttcgcgctgggcctcaag
ggtgatcaggtgaaggcggcgggcaagctcgtcgagaacctctaccgcatggtcgtcgag
aaggacatgagtctgctcgagatcaatccgctggtcgtcaccaaggacggcaagctcatc
tgcctcgacggcaagatgaatttcgactccaacgccctttatcggcaccccgaaatcgtc
gagctgcgcgacctcggcgaagaagatcagaccgagatcgaagcctcgaagcacgacctc
gcgttcgtcaagctcgacggcaacatcggctgcctcgtcaacggtgccggcctcgcaatg
gcgacgatggacatcatcaagctttatggtgcggagcccgccaacttcctcgacgtcggc
ggcggtgcgtcgaaggaaaaggtgcgcgaagccttcaagatcatcctcgccgacccgtcc
gtgaagggcatcctggtcaatatcttcggcggcatcatgcgttgtgacatcatcgcggaa
ggcgtgatcgcggcggcccgcgaaatggacatcaaagtgcccctcgtcgtgcgccttgaa
ggcaccaacgtcgatctgggtaagaaaatcctaaaggagtcgggtctcaagatcattccc
gccgacgaccttgcggatgccgccaaaaagatcaccgacgagttgaaacaggtcgcctga

DBGET integrated database retrieval system