KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3260Help
Entry
Hden_3260         CDS       T01265                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Hden_3260
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Hden_3260
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Hden_3260
Lipid biosynthesis proteins [BR:hdn01004]
 Fatty acid synthase
  Component type
   Hden_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3335742..3336443
Genome map
AA seq 233 aa AA seqDB search
MNVRHRLRTAPALVVTFALSILVAVGVAAIVAPFSVSADEAQPVTLVAFGDSLTAGYGVK
ASESFPAQLQMALQAKGYKVTVVNAGVSGDTTADGLRRFDWAMQPKPDGVILELGANDAL
RGIDPKEPSANLDKMLASLKSLDVPVLLTGMKAPNNWGDDYVKAFDAIYTGLAAKYDVSL
YPFFLDGVALDPGFSQPDGLHPTASGIGEVVKRILPDVEALVQRISQRKTAAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcgccacaggcttcgaacggctccggcgttggtcgtgacatttgccctctca
attctggtggctgttggcgtggcggcgatcgtcgcgccgttttcggtatcggccgacgag
gcgcaacccgtcaccctcgtcgcgttcggcgatagccttacggcaggctacggcgtcaag
gccagcgagtcgtttccggcgcagcttcaaatggcgcttcaggcgaagggctacaaggtc
accgtcgtcaatgctggcgtttcgggtgacacgacggcggatggccttcgccgattcgac
tgggcgatgcagccgaagccggacggcgtcatcctcgaactcggcgccaacgatgcgttg
cgcgggatcgatcccaaggaacccagcgccaacctcgacaagatgctcgcttcgctcaag
tcgctggacgtgcccgttcttctcaccggcatgaaagcgccgaacaattggggcgatgat
tacgtcaaggcgttcgacgcgatctacacaggcctcgccgccaaatacgacgtctcactg
tatccgtttttcctcgacggcgtggcgctggacccggggttttcccagccggacgggttg
catccgaccgcgagcggcatcggcgaagtcgtcaaacgcattctgcccgacgtggaagcg
ctggttcagcgtatctcgcagcggaagacagcggcaaaatag

DBGET integrated database retrieval system