KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3449Help
Entry
Hden_3449         CDS       T01265                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hden_3449
Enzymes [BR:hdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hden_3449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3522157..3522897)
Genome map
AA seq 246 aa AA seqDB search
MHVLVTRPKDDGETLKAELEQLGCKVTLEPLIRIVSNDIPATAIDETSTLIITSRNALRA
LAKSPALTRALTRPLLAVGPGTAALAREMGFTDIFEGPGTGAELVPEITRRSEAGGGAFV
YLSADRMAFDVPSALAERGIAIRRVVAYRSVAAETLSPQVADALRDGAINVVVLMSPRTS
ETWAKIAPVAAKPNDLSDISYVCISEAVANVVKSELGPQAIIVANRPNHEEILIVLKRLA
ARPEAE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttcttgtcacgcgtcccaaagacgacggcgagacgctgaaagcagagcttgaa
cagctcggctgcaaggtgacgcttgagccgctgatccgcatcgtttcgaacgacattccc
gcgacggccatcgacgaaacgtcgacgctcatcataacgagccgcaacgccttaagagcg
ctggcgaagtcaccggctcttacgcgcgcgttgacccggccgttgcttgccgtcggtccc
ggcaccgccgctctcgcgcgcgaaatggggttcaccgacatcttcgaaggacccggaacc
ggcgccgagctcgttcccgaaattacccggcgatcggaagccggcggcggagcgttcgtt
tacctttcggccgatcgcatggccttcgatgtcccgtctgctcttgccgaacgcggcata
gcgatccggcgggtcgtcgcctatcgatctgttgcagcggaaacgttgtcgccacaggtt
gccgatgcgcttcgcgacggcgcgatcaatgtcgtcgttttgatgtcgcccagaacgtcg
gaaacctgggcgaaaattgcccccgtcgccgcaaaaccgaacgatctttcagacataagc
tacgtctgcatttctgaagccgtcgccaatgtcgtgaaatcggagctcggtccgcaagcc
atcatagttgccaaccgtcctaaccacgaagaaatacttatcgtgctgaaacgtctcgcg
gcacgtccggaagcagagtaa

DBGET integrated database retrieval system