KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3455Help
Entry
Hden_3455         CDS       T01265                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00010  Glycolysis / Gluconeogenesis
hdn00620  Pyruvate metabolism
hdn00640  Propanoate metabolism
hdn00680  Methane metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_3455
   00620 Pyruvate metabolism
    Hden_3455
   00640 Propanoate metabolism
    Hden_3455
  Energy metabolism
   00680 Methane metabolism
    Hden_3455
Enzymes [BR:hdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hden_3455
Lipid biosynthesis proteins [BR:hdn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hden_3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADJ25246
JGI: Hden_3455
UniProt: D8JY42
Position
3527571..3529520
Genome map
AA seq 649 aa AA seqDB search
MSDKVYPVPAEWAERAYINADQYRELYERSVSDPEGFWSDAGKRLEWIKPYSRAKNTSFQ
PGNVDIRWFEDGTLNVSANCIDRHLATRGDQVAIIWEGDNPNESETITYRQLSERVQRFA
NVLKKHGVKKGDRVTIYLPMIPEAAYAMLACTRIGAVHSIVFGGFSPDSLQNRIEDAESS
VIITADEGLRGGKPVPLKKNADAALAKCTGDKKMLVVRRTGNPVAWTPGRDLWLHEELES
VSGECPPEEIGAEDPLFVLYTSGSTGKPKGVVHTTGGYLLYASMTHQYVFDYHDGDIYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPSASRFWDVVDKWKVSIFYTAPTAIRS
LMGAGDDLVKRSSRSSLRLLGSVGEPINPEAWEWYYNVVGEGRCPIVDTWWQTETGGIMI
SPLPGATDLKPGSGTKPFFGVQPALVDDKGQLLEGEAQGNLVILDSWPGQSRTIYKDHDR
FEKTYFSAYPGMYFSGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVSHPKVA
EAAVVGYPHDLKGQGIYCYITLIIGENGDDGLKKDLVAHVRREIGPIASPDLIQFSPGLP
KTRSGKIMRRILRKIAEDDFGNLGDTSTLADPAVVDELITNRQNKRGAA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaaagtttatcccgttcccgctgagtgggcggaacgcgcgtacatcaacgcc
gatcaataccgggaattgtatgagcggtccgtctccgatcccgaggggttctggtcggac
gccggcaagaggctcgagtggatcaaaccttacagccgcgccaagaacacctcgttccaa
cccggcaacgtcgacatccgctggttcgaggacgggacgctcaacgtctccgcgaactgc
atcgaccggcatctggcaacgcgcggcgatcaggtggcgatcatttgggaaggcgacaac
ccgaacgaaagcgagacgatcacctaccggcaactctccgagcgcgtgcagcggttcgcg
aacgtgctcaagaagcacggcgtcaagaaaggcgaccgcgtcacgatctatctgccgatg
attccggaagcagcttacgccatgctcgcctgcacgcgcatcggcgcggtgcattcgatc
gttttcggcggcttctcgccggacagcttgcagaaccgcatcgaagatgcggagtcgtcg
gtcatcatcaccgcggatgaaggtctgcgcggcggcaaacccgttcctctgaaaaagaat
gccgatgccgcgctcgccaaatgtactggcgacaaaaaaatgctcgtcgtgcgccgcacc
ggcaacccggtggcatggacgccggggcgggatctttggctgcacgaggaactcgaatcc
gtttccggcgaatgcccgccggaagaaatcggcgcggaagatccgctgttcgttctttat
acgtcgggatcgacgggcaagccgaagggtgtggtgcatacgaccggcggctatctgctt
tatgcgtccatgacgcaccagtacgttttcgactaccacgatggcgacatctactggtgc
accgccgacgtcggctgggtgacgggtcacagctacatcgtctacggcccgcttgcgaac
ggcgcgacgacattgatgttcgaaggcgttccgacatatccgagcgcgtcgcgcttctgg
gacgttgtcgacaagtggaaggtgtcgattttctacacggcgccgacggcgatccggtcg
ctgatgggcgcgggcgatgatctcgtcaaacgctcgagccgttcctcgcttcggcttctc
gggtcggtcggtgagccgatcaatccggaggcgtgggagtggtattacaatgtcgttggc
gaaggccgttgcccgatcgtcgatacgtggtggcagacggaaaccggcggcatcatgatc
tcgccgcttcccggcgcaaccgacttgaagccggggtccgggacgaagccgttcttcggc
gttcagccggcgctggtcgacgacaaggggcaattgctcgagggcgaagcgcagggcaac
ctcgtcatcctcgatagctggcccggccagtcgcggacgatctacaaagatcacgatcgt
ttcgaaaagacgtacttctcggcctatcccggaatgtacttcagcggcgacggctgccgg
cgcgatgccgacggctattactggatcaccggccgcgtcgacgacgtcatcaacgtttcc
ggtcaccgcatgggaacggcggaagtcgagagcgcgctggtctcgcatcccaaggtggcg
gaagccgccgtcgtcggatatccgcacgatctcaaggggcagggcatttactgctacatc
acgctcatcattggcgagaacggcgacgacggcctgaagaaagatcttgtcgcgcacgtg
cgccgtgaaatcgggccgatcgcgtctccggatctcatccagttttcgccgggcctgccg
aaaacgcgatcgggcaagatcatgcgccgcattctgcgcaagatcgccgaggacgatttc
ggaaatctcggtgatacctcgacgcttgccgatccggcggtcgtcgacgaactgatcacg
aaccgccagaacaagcgcggtgccgcctag

DBGET integrated database retrieval system