KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3546Help
Entry
Hden_3546         CDS       T01265                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Hden_3546
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Hden_3546
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Hden_3546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3635705..3636586
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLAPVVTGRRIAAVELRRPNLRFPFPERFAERLVGQRIDRLERRAKYL
IAELSGGEDLVMHLGMTGRFTILEKGRTDTPGEYVNSVGADPVHDHVVFKLTGGARIVYN
DPRRFGFMVMMPHAERSEHPLFRALGVEPLGSELTADYLAARARGKKANLKAFLMDQRIV
AGLGNIYVAEALFRSGLSPNRVARALADRRGAPTERAEKLVPAIREVLEQAIDARGSTLR
DYRDASGASGGFQNSFAVYDRAGRPCPRAGCGGEIRRVVHAGRASFYCPRCQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttcccgaagttgaaactgtccggcgcggcctggcgccggttgtcaccgga
cggcgcatcgccgcagttgagctgcgccgtcccaatctcagatttccatttccggagcga
tttgccgaacggctggtcgggcagcggatcgaccggctcgagcggcgggccaaatatctg
atcgctgagctttcgggcggcgaagacctcgtcatgcacctcggcatgacggggcggttt
acgattttggagaaagggcggacggatacgccgggcgagtacgtcaacagcgtcggcgcc
gatcctgtgcacgatcatgtcgtgttcaagctcacgggcggggcgcgcatcgtctacaac
gacccgcgccgcttcggcttcatggtcatgatgccgcatgctgagcgatccgagcatcct
ttgtttcgcgcgcttggcgtcgagccgctgggctcggaattgactgcggattatctcgcg
gcgcgggcgcgcggaaagaaggccaatctgaaagccttcctgatggatcagcggatcgtc
gcgggtctcggcaatatctatgtcgcggaggcgctgttccggtctggcctgtcaccgaac
cgtgtggcgcgggcgttggcggacaggcgcggcgcgccaacggagcgcgccgagaagctc
gttccggcgatccgagaggttctcgaacaggcgatcgatgcgcggggttcgaccttgcgt
gattatcgcgatgcgagcggcgcgtcgggtggatttcagaattcgttcgccgtttatgat
cgcgctgggcgaccgtgcccgagagctgggtgcggcggagagatccgacgtgtggtgcat
gctggacgggcgagcttttattgtccgcgctgtcagcgctga

DBGET integrated database retrieval system