KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_23328Help
Entry
HYPDE_23328       CDS       T02646                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hdt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HYPDE_23328
Enzymes [BR:hdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HYPDE_23328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159137..160120
Genome map
AA seq 327 aa AA seqDB search
MREPRSIRSFSRSRERRTVGPFRKVKQLALMSILVIGNAVLDRSFLVDRLPYPGETMIAR
DSRVDCGGKGLNQAVAAARAGATVTLHAMVGDDEPGRKILAALREEQMVLPANPIRSGPT
DEATVLLLPGGENSIICSAHATAHIDLQSGLTALEHFGSDDWLISQGNTDRATTEDTLLC
ARRRNVRTIVNPSPPLFDYTGLWPMIDILILNAGEARTLGGHDDFDLAAARMLGFGCHKI
IITLGPDGARIYGSDQQRHCSVAAPEMKIADTTGAGDTCCGVMAAGLDAGLDLESAVAWG
VRCATLKATRWGSLSALPSREEIDRLR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggagccgcgttcgatccgctcgttctcgaggtcacgcgaacggcgaaccgtcggc
ccgtttcgaaaggtgaagcaactcgccctcatgagcatcctcgtcatcggcaacgcagtt
ttagaccggtccttccttgttgatcggctaccctatccgggcgagacgatgatcgcgcgc
gatagccgtgtcgactgcggtggcaagggcttgaatcaggcggtcgccgctgcccgagcc
ggtgcaacggttactctgcacgcgatggtgggagatgacgaaccgggacgtaagatattg
gccgctttgcgggaagagcagatggtgctccctgcgaatcctattcgctccggcccaacg
gatgaggccactgtgctattgctgcccggaggtgagaattcgattatctgctcggcacat
gccacggcgcacattgatttgcaatcgggtctcactgcccttgagcactttggctcagac
gattggctcattagccaagggaataccgaccgcgcgacgaccgaggatactttactctgc
gcgcgaagacgtaacgtccgcactattgtgaatccttcacccccgctcttcgactacacg
gggctatggccaatgattgatatcctcatcctcaatgccggagaagcccgcacacttggg
ggtcatgatgacttcgatttggcagcagcacgaatgttggggttcgggtgccacaagatc
ataattactttgggaccagatggcgcgcggatatatggctcggaccaacagcggcactgc
tctgtcgctgcgcctgagatgaagatcgctgatacgaccggagctggagacacgtgttgt
ggcgtcatggccgcgggacttgacgccggcctggatctcgagagcgccgttgcgtggggt
gttcgctgtgcgaccttaaaggccactcgctggggtagcctgtcggcgcttccctcgcgc
gaagagattgaccggctacgttaa

DBGET integrated database retrieval system