KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_23588Help
Entry
HYPDE_23588       CDS       T02646                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HYPDE_23588
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HYPDE_23588
Enzymes [BR:hdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HYPDE_23588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204312..205634
Genome map
AA seq 440 aa AA seqDB search
MSRKPHARGPAFGKNQLVWLICGIGLLPECAHLQISTRRSGASRIRLDFQSGIDMVRAPQ
SAATIATARPEWAKARRIVVKIGSALLTDQKTGRIKSDWLNSFMDDVAELARAGKDIVLV
SSGSIALGRHALKLPKGPLELEQSQAAASVGQISLAHAYQELAAARGLTAAQILLTLGDT
EERRRYLNARNTIEVLLALKAIPVVNENDTVATAEIRYGDNDRLSARVASMVSADCLVLL
SDVDGLYTAPPGEDQNAKHIPLVSEITPEIEAMAGDAGTELSKGGMKTKIEAGKIALSAG
TDMVITTGKVLNPLRAISEGARVTWFVAKSDPVTARKRWISGQLEPSGHVYLDAGAEKAL
MSGKSLLPAGVTRIDGSFDRGDAVTIRSANGRELGRGLVAYAADDARRIIGKRSSEIAAI
LGFEGRATLIHRDDMALTRK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgtaagccgcacgccaggggtccggcatttggtaaaaatcaacttgtctggctg
atatgcggcatcggcctcttgcccgaatgcgcgcatttgcagataagcacgcgaagatcc
ggtgcatcgcgcatccggctcgactttcaatccgggattgacatggtccgcgctccgcag
tccgcagctacgatcgctaccgcgcgccctgaatgggcaaaggcgcggcgcatcgtcgtg
aaaatcggctcggcgctgctgacggaccaaaagaccggccggatcaaatcggactggctc
aattcgttcatggacgacgttgccgagcttgcacgggcaggcaaagacatcgtgctcgtc
tcgtcaggctccatcgcgctggggcggcacgcattgaagctgccgaaagggccgctcgaa
ctcgagcaaagccaggctgcggcgtctgtcgggcagatcagcctcgcgcatgcctatcag
gaactcgcggcggcgcgcgggctgacggcggcgcagattctcctgacgctcggcgatacg
gaagaacggcggcgctacttgaatgcacgcaacacgatcgaggtgctgctggcgcttaag
gctattcctgtcgtgaacgagaatgatacggtcgccacggctgaaatccgctatggcgat
aacgatcggctgtcggcacgcgttgcatcgatggtgtcggcggattgcctcgtgctgttg
tccgatgtcgacgggctctacacggcgccgccgggcgaagaccagaacgccaagcatatt
ccgctcgtctcagagattacgcccgagatcgaggctatggcgggggatgccggcacggag
ctttccaaaggcggcatgaagacgaagatcgaggccggaaagatcgcgctgtcggccgga
accgatatggtcatcacgaccggaaaagttctcaatccgctcagggccatctcggaaggc
gcgcgggtcacgtggttcgtcgccaagtccgacccggtgacggcaagaaagcgctggata
tccggtcagctcgagccgagcggacacgtttacctcgatgcgggcgccgagaaggctctg
atgtcgggaaaaagccttttgccggcgggcgtcacccgtattgacggctctttcgaccgc
ggcgatgccgttacgataaggtccgcgaacggccgggaactcggacgtggtcttgtcgcc
tatgcggcggacgacgcgcgacgtatcataggcaagcgttccagcgagatcgccgcgatc
ctcgggttcgaggggcgcgcgacgctgatccaccgggacgatatggcgctgacgaggaaa
tag

DBGET integrated database retrieval system