KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_25013Help
Entry
HYPDE_25013       CDS       T02646                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HYPDE_25013
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HYPDE_25013
Enzymes [BR:hdt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     HYPDE_25013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(494351..494902)
Genome map
AA seq 183 aa AA seqDB search
MQVTDLEIEGLKLIVPQRFEDERGFFSETYSEKALKEAGLTDTFVQDNFSLSTRRGTIRG
LHFQRAPHAQVKLVRVNRGRILDVAVDLRRSSPTYGKHVAVELSRENWGQLYLPVGFAHG
FCTLEADTEVVYKTSSPYAPEAEGGILWSDPSLAIAWPVNPQDVTVSDKDTRLPSFANMA
MAF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttacggacctcgaaattgaaggcttgaaactgatcgtcccacagcgctttgag
gatgagcgcggatttttctcggaaacctatagcgaaaaggctctgaaggaggccgggctg
acggacacgttcgtccaggacaatttttcactgtccacacgcagaggaacgatacgcggc
ctgcattttcagcgagcacctcacgcccaggtcaaactcgtccgggtgaacagaggccgc
atcctcgacgtagccgtcgatctgcgacgatcctcccccacctatggcaagcatgtcgcc
gtcgagctgtcgcgggaaaactggggccagctttacctgccggtcggattcgcccatggc
ttctgcacgctggaggccgacaccgaggttgtctacaaaacctccagtccctatgcgccg
gaagcagaaggcggaattctgtggtccgacccgagcctcgcgatagcttggccggtcaac
ccgcaggatgtgacagtttccgacaaggatacgcggctaccctccttcgcaaatatggcc
atggccttctga

DBGET integrated database retrieval system