KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_25168Help
Entry
HYPDE_25168       CDS       T02646                                 

Definition
catalase related subgroup
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HYPDE_25168
  Amino acid metabolism
   00380 Tryptophan metabolism
    HYPDE_25168
Enzymes [BR:hdt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     HYPDE_25168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523389..524369
Genome map
AA seq 326 aa AA seqDB search
MKEAAIPVLIATAISLLAITTNAEEATPDAVIDALNGVFGVHQGARAVHAKGTVLTGTFT
ASPEAAALSTAPHLQTGASVPVTVRFSNFAGIPTIADNDGLASPRGMAVKFKLADGSETD
IVAHSFNGFPVATTNEFRQLLVALGTSKPDTPKPTPLDKFLGDHPIAKAFLTAAKPNPVS
YASLPYYGVNAFKFTNKDGKATFVRYQIVPFGGEHYLSEADAKTATASYLSDEIKKRVGQ
GPVTFNLVAQIADAGDKVDDPSIAWPADRKTVSLGTISLTASAGDDAANPQLVFMPNAVP
AGIEAADPMVADRAATYAVSFARRHP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagctgcgattcccgtgctgattgccaccgcgatctctttgcttgcgatcacg
accaatgcggaagaggctactcccgacgcggtgatcgatgcgctcaatggcgtttttggc
gtccaccagggtgctcgtgccgttcatgccaagggaacggttctgaccggaacgtttact
gcatcgcccgaagccgcagcgttgtcgacggcgccgcatttgcaaaccggggcgagcgta
cccgttacggtccgcttttcaaattttgccggcattccgacgattgccgacaacgatggc
ttagccagtccgcgcggtatggcggtcaagttcaagctggcggacggttcggaaacggac
atcgtcgcgcattccttcaacggctttccagtcgccacgaccaacgagttccgtcagctt
ctcgttgcgcttggtacgagcaagcccgatacgccgaaacccacaccgctcgataagttc
ctgggtgatcatcccattgccaaggcgtttctgaccgcagccaagcccaacccggtgagc
tacgccagtctcccgtactatggtgtcaacgccttcaaattcacgaacaaggacggcaag
gcgacgttcgtacgataccaaatcgtgccgttcgggggtgagcactatctgagcgaggct
gacgcgaagacggcgacggcttcctatttgagcgatgaaatcaagaagcgcgtcggccaa
ggtccggtgactttcaatcttgtcgcccagatcgccgatgccggcgacaaggtcgatgat
ccatcgatcgcgtggccggccgatcgcaagacggtttcgcttgggacgatctcgctcacg
gcgagtgcgggggacgacgctgcaaatccgcagctcgtcttcatgcccaacgcagttcca
gctgggatagaggcggccgatccgatggttgcggatcgtgcagccacgtatgccgtgtcc
ttcgcgcgcagacatccttga

DBGET integrated database retrieval system