KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_28688Help
Entry
HYPDE_28688       CDS       T02646                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202477..1203331)
Genome map
AA seq 284 aa AA seqDB search
MATDAGFKIKGGKVGILLLHRLCGTPVEMRFVASGLAKQGYTVHCPTLAGHCGSEDELKA
SSWTDWYRSAELALDDLKKDCDVVIAGGLSAGAVLAILLAAKKPTKVDATALLAPTLWLN
GWMIPWYARLFRLVRFKWFANLFSFPHHDPHGIKDERIRDFIRRARASRSSAEAGNPATP
GGAVFEHRQMVNAVRKLVAFVRQPTLIVHPLEDDYAAMSNATYLRDSLGGPVNLEVLDDC
YHVVTVDRQRHLVVDAIDRFVANLIGVRVEAPGQRTALGKISAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagacgcaggcttcaaaatcaaaggcggaaaagtcggcatcctgctgctgcat
cggctgtgcggaacgccggtcgaaatgcgcttcgtggcgagcggcctcgccaaacaggga
tacaccgtccactgcccaactcttgccgggcactgcggcagcgaggacgagctgaaagcc
tcctcctggaccgactggtatcgcagtgccgagctggccctcgatgatctcaagaaggac
tgcgatgtcgtcatcgcaggcgggctgtcggcgggtgctgtcctcgcgatcctgcttgcc
gcaaagaaaccgacgaaagtcgacgcaacggcactgcttgcgccgaccctctggctcaac
ggctggatgatcccctggtacgcgcggctattccggctcgtccgcttcaagtggttcgcg
aaccttttcagctttccacaccacgatccgcacggcatcaaggacgagcggattcgggat
tttatccggagggcgcgagcctctcgcagcagcgctgaggccggcaatcctgcgactccc
ggcggtgccgtgttcgaacacaggcagatggtgaatgcggtccggaagctcgtcgccttt
gtccgccagccgaccctgatcgtgcatccactcgaagacgactacgccgcgatgagcaac
gcaacctatctccgcgacagccttggaggtcctgtcaatctcgaggttctggatgattgc
taccatgtcgtcaccgtcgaccggcagcgccacctcgtcgtcgacgccatcgaccgcttc
gtcgccaacctcatcggtgttcgggtggaagcacctgggcagcgcacggccctcggtaaa
atctcggcagcttaa

DBGET integrated database retrieval system