KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_32333Help
Entry
HYPDE_32333       CDS       T02646                                 

Definition
DNA polymerase LigD, ligase domain-containing protein
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hdt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    HYPDE_32333
   03420 Nucleotide excision repair
    HYPDE_32333
   03430 Mismatch repair
    HYPDE_32333
   03450 Non-homologous end-joining
    HYPDE_32333
Enzymes [BR:hdt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HYPDE_32333
DNA repair and recombination proteins [BR:hdt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HYPDE_32333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942482..1943552
Genome map
AA seq 356 aa AA seqDB search
MTRRRSVMTPRARTTAARVTAKPRSRALSPSSLAAAVRGPLPDFVEPCLATLVAAPPEGD
DWVHEIKFDGYRIQARIDGDNVRLITRGGLDWTERFGAVPALLRKLHCDKALIDGELVVE
DSSGHSSFTELAAALKGGRSERFVFQCFDLLHLDGFNLMPAALIDRKDLLRQLLADQASP
EIRYSEHLSGNGARMLREACHLGLEGLVSKRADRPYRSGRHDEWLKSKCIQIDEFVVIGY
VVSNMSAGAVGALVVGYFERKRLMYAGRVGTGFTQQTAAALMRELKPLKTAAPPFASQLT
GVQRKGVIWVEPVVVAQIEYRAWTADNLLRHAAFKGLREDKPAAEVRRPLIKSPKS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcagaaggtcggtcatgactccccgcgcgcgcaccacggcggcgcgggtgacg
gcgaaaccgcggagccgtgcactctcgccgagctcgctcgcggccgccgtcaggggcccg
cttccagatttcgtcgagccgtgtcttgcgacgctcgtcgcggcgccccccgagggcgac
gactgggtgcacgagatcaagttcgacggttatcgcattcaagcccgcatcgacggcgat
aacgtgcggctcattacgcgaggcgggctcgactggaccgagcgattcggcgcagttccg
gcgctcttgcggaaactacattgcgacaaggcgctgatcgacggagagctggtcgtggaa
gatagctcggggcattcgagcttcacggaactggcggcggcgctgaaaggcggacgttcg
gaacgcttcgtctttcaatgtttcgatcttctgcatctcgacggcttcaatctgatgccc
gctgcactgatcgaccgcaaagatctccttcgccaattgctcgcggatcaagcgtcgccg
gaaatccgctatagcgagcacctctcgggtaacggggcccgcatgctgagagaggcctgc
cacttgggtcttgaaggccttgtctccaaacgcgccgacaggccgtaccgctcgggccgc
cacgacgaatggctgaagagcaagtgcatccagatcgacgaattcgtcgtcattggttac
gtcgtctcgaatatgtcggcgggtgcggtcggcgcgctcgttgttgggtatttcgaacgg
aaacgcctgatgtatgccgggcgcgtcggaacgggcttcacgcagcaaacggccgccgca
ctgatgcgcgagctgaagccactaaagaccgccgcacctccattcgcgtcgcaattgacg
ggcgtgcaacggaaaggcgttatttgggtcgagccggttgtcgtcgcgcaaatcgaatac
cgcgcctggacggcggacaacctgttgcgacacgccgccttcaaggggctacgcgaagac
aagccggcagccgaagtccggcgcccacttatcaaatccccaaagagctga

DBGET integrated database retrieval system