KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_41828Help
Entry
HYPDE_41828       CDS       T02646                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hdt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3804908..3805789
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLAPVVVGRRITAVETRRPDLRFPFPERFAERLVGQRIVGLGRRAKYL
IAGLSGGEDLVMHLGMTGRFTILENGRRDTPGEYANRVGADPVHDHVVLKLSGGVHIVYN
DPRRFGFMVMMPHAERSEHPLFRGLGVEPLGPELTADYLASRARGKKANLKSFLMDQRIV
AGLGNIYVAEALFRAGLSPNRAARALADRRGAPTERAKKLVPAIREVLEQAIAARGSTLR
DYRDANGASGGFQNSFAVYDRAGRTCPRAGCGGEIRRVVHAGRTSFYCPRCQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactccccgaagttgaaaccgtccggcgcggcctcgcgccggttgtcgtcggc
cgtcggatcaccgctgtcgaaacgcgccgcccggacttgaggtttccgtttccggagcga
tttgccgagcggcttgtcgggcaacggatcgtcgggctcggccggcgcgccaaatacctg
attgcagggctttcgggcggcgaggaccttgtcatgcacctcggcatgacgggccggttt
acgattctggagaacgggcggcgagatacgccgggggaatatgcgaaccgcgtcggagcc
gatccggtgcacgatcatgtcgtgctcaaactctccggcggagtgcacatcgtctacaac
gacccgcgccggttcggcttcatggtcatgatgccgcatgccgagcgatcggagcatcca
ctctttcgtggacttggcgtcgagccgctgggaccggagctgacagcggactatttggct
tcgcgggcgcgcggaaagaaagccaatctgaaatcctttctgatggatcagcgcatcgtc
gcggggctcgggaacatctatgttgcggaagcgctgttccgcgccggcctgtcgccgaac
cgtgcggcgcgagcgctggcggaccgccgcggcgcaccaaccgaacgggcgaaaaaactc
gttccggcgatccgcgaggttctcgaacaggcgatcgctgcccgcggatcgacattgcgc
gattatcgggatgcgaacggcgcatccggcggatttcagaattcgttcgccgtctacgat
cgggcggggcggacatgtccgcgagccggatgcggtggcgaaatccgccgtgtggtacat
gcgggtcgtacgagcttttattgtccgcgctgtcagcgctga

DBGET integrated database retrieval system