KEGG   Haemophilus ducreyi: HD0053Help
Entry
HD0053            CDS       T00135                                 

Definition
hypothetical protein
Orthology
K12248  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 0160) [EC:2.4.99.1]
Organism
hdu  Haemophilus ducreyi
Brite
Enzymes [BR:hdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     HD0053
Glycosyltransferases [BR:hdu01003]
 Terminal extension
  Bacterial sialyltransferase
   HD0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46609..47808)
Genome map
AA seq 399 aa AA seqDB search
MLIQQNLEIYLDYATIPSLACFMHFIQHKDDVDSIRLFGLARFDIPQSIIDRYPANHLFY
HNIDNRDLTAVLNQLADILAQENKRFQINLHLNLFHSIDLFFAIYPIYQQYQHKISTIQL
QLYDDGSEGIVTQHSLCKIADLEQLILQHKNVLLELLTKGTANVPNPTLLRYLWNNIIDS
QFHLISDHFLQHPKLQPLKRLLKRYTILDFTCYPRFNAEQKQLLKEILHISNELENLLKL
LKQHNTFLFTGTTAFNLDQEKLDLLTQLHILLLNEHQNPHSTHYIGNNYLLLIKGHANSP
ALNHTLALHFPDAIFLPANIPFEIFAMLGFTPNKMGGFASTSYINYPTENINHLFFLTSD
QPSIRTKWLDYEKQFGLMYSLLAMQKINEDQAFMCTIHN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgattcaacaaaatcttgaaatttatcttgattatgcaactatcccaagcttggct
tgttttatgcattttattcaacataaagatgatgttgatagcattcgtttatttggtcta
gcacgttttgatattccacaatcaattatcgatcgctatcctgctaaccatttgttctac
cataacatcgataatcgtgatcttactgccgtattaaatcaactagcagacattcttgcc
caagagaataagcgcttccagatcaatctacatttaaacctatttcacagcatcgactta
ttttttgccatttacccaatctatcagcaatatcaacataaaatttcaactattcaatta
cagctttatgatgatggctcagaaggcattgtcacccagcattctttatgtaaaatagcc
gatcttgagcaactgattttgcaacataaaaatgtattactagaactgcttactaaaggc
actgctaacgtgcctaatcctactttgctccgctatttatggaataacattattgatagc
caatttcacttgatttctgatcatttcctccagcatcctaaattacaaccgctaaaacgc
ttattaaaacgttatacaattttagattttacttgttatcctcgctttaatgctgagcaa
aaacaactcctcaaagaaatattgcatatctctaatgagctagaaaacttattaaaactg
ctcaaacagcataatacttttttatttacgggcacaaccgcctttaacttggatcaagaa
aaacttgacttattaacacaactacatattttgttgcttaatgagcaccaaaatccccac
tcaacgcattacattggcaataattatttattactgattaaaggccacgcaaatagtcct
gctttgaatcatactttagctttacattttcctgatgcaatattcctgcctgctaatatt
ccatttgagatctttgcaatgctaggttttacgcccaataaaatggggggctttgctagc
actagctacattaattatccaacagaaaatataaatcatctgttcttcttaacctctgat
cagccgtctattcgaaccaaatggttggattatgaaaagcagtttggcttaatgtatagt
ttattagccatgcaaaaaatcaatgaagatcaagcatttatgtgtacaatacataattaa

DBGET integrated database retrieval system