KEGG   Haemophilus ducreyi: HD0211Help
Entry
HD0211            CDS       T00135                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hdu  Haemophilus ducreyi
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hdu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hdu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hdu03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hdu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hdu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152892..153296
Genome map
AA seq 134 aa AA seqDB search
MNRRDLLLEEMGITQWQLTKPQVLKGEAQICLDNRIKLVIVCQERHHTTQLFQDILLTLN
IQKEQYQWFDFAQAKRLVFQHQPIFWLIGDAEQAVAFAHQNANLPIWQNESWHQLAFVAT
KRQFWQQIAPFANG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggcgagatttgctattagaagagatggggattactcagtggcaattaactaag
cctcaagtattgaaaggcgaagcgcagatttgcttagataatcgtattaagttagttatt
gtttgccaagaaaggcaccacaccacgcagctatttcaagatattttattgactttaaat
atacaaaaagaacaatatcagtggtttgattttgctcaagcgaagcggttggtttttcaa
catcagccgattttttggttaattggtgatgctgaacaagcggtagcctttgcacatcaa
aatgctaatttgcccatttggcagaatgaatcttggcatcaattagcatttgttgccaca
aagcgccaattttggcaacaaatagcaccatttgctaatggttga

DBGET integrated database retrieval system