KEGG   Haemophilus ducreyi: HD0465Help
Entry
HD0465            CDS       T00135                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hdu  Haemophilus ducreyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hdu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hdu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hdu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hdu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hdu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hdu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:hdu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366131..367105
Genome map
AA seq 324 aa AA seqDB search
MAKEIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEIFGVQDGYYGLYHDKVIPLDRRS
VSEIINRGGTFLGSARFPQFKDIEVRKQAVKILAKYEIDALVVIGGDGSYMGAKLLTEEF
GYPCIGLPGTIDNDIVGTDYTIGYQTALQTAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALAGGCEYIIVPEKGLDKESLIHSIADNFRKGKRHAIIAITELMTDVHQLARELE
EKFGHETRATVLGHIQRGGSPCPFDRILASRMGVYAVDLLRQGFGGRCVGIQNEHLVHHD
IIDAINNMRRPFKQDIFEAASKLA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaatcaagaaaattgcagtgttgaccagtggtggtgatgctcctggtatg
aatgcggcgattcgtggtgtggttcgagcagcattaaatgaaggtctagaaatcttcggt
gttcaagatggctattatggtttgtatcacgataaagtgattccattagatcgccgttct
gtctcggaaattattaaccgtggtggtacttttttaggttcggcacgttttccacaattt
aaagatattgaggttcgcaaacaagcggtcaagattttagcaaaatatgaaattgatgct
ttggtggtgattggcggtgacggatcttatatgggcgctaaattactcacggaagaattt
ggttatccgtgtataggcttgccgggcacaattgataatgatattgttggcactgattat
actattggttatcaaaccgctttacaaacggccgttgaggcaattgaccgtttacgcgat
acttctacctcacaccagcgtatttcgattgtagaaattatgggacgccattgtggtgat
ttaaccattagtgcagcattagccggtggttgtgaatatattattgtgccagaaaaaggt
ttagataaagaatcgcttattcatagtattgctgataatttccgcaaaggtaaacgtcac
gcaattattgctattacggaattaatgacagatgtgcatcaattggcaagagaattagaa
gaaaaatttggccatgaaacacgggctaccgtgttaggccatatacaacgagggggttca
ccttgtccatttgatcgtattttagcctcccgtatgggagtctatgcggttgatttatta
cgtcaaggttttggtggtcgttgtgtcggcattcaaaatgagcatttagtgcatcatgat
attattgatgcaattaataatatgcgacgtccatttaaacaggatatatttgaagcggct
agtaaattagcctaa

DBGET integrated database retrieval system