KEGG   Haemophilus ducreyi: HD0465Help
Entry
HD0465            CDS       T00135                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hdu  Haemophilus ducreyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HD0465 (pfkA)
   01230 Biosynthesis of amino acids
    HD0465 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HD0465 (pfkA)
   00030 Pentose phosphate pathway
    HD0465 (pfkA)
   00051 Fructose and mannose metabolism
    HD0465 (pfkA)
   00052 Galactose metabolism
    HD0465 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HD0465 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HD0465 (pfkA)
Enzymes [BR:hdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HD0465 (pfkA)
Protein phosphatases and associated proteins [BR:hdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HD0465 (pfkA)
Messenger RNA biogenesis [BR:hdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HD0465 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366131..367105
Genome map
AA seq 324 aa AA seqDB search
MAKEIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEIFGVQDGYYGLYHDKVIPLDRRS
VSEIINRGGTFLGSARFPQFKDIEVRKQAVKILAKYEIDALVVIGGDGSYMGAKLLTEEF
GYPCIGLPGTIDNDIVGTDYTIGYQTALQTAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALAGGCEYIIVPEKGLDKESLIHSIADNFRKGKRHAIIAITELMTDVHQLARELE
EKFGHETRATVLGHIQRGGSPCPFDRILASRMGVYAVDLLRQGFGGRCVGIQNEHLVHHD
IIDAINNMRRPFKQDIFEAASKLA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaatcaagaaaattgcagtgttgaccagtggtggtgatgctcctggtatg
aatgcggcgattcgtggtgtggttcgagcagcattaaatgaaggtctagaaatcttcggt
gttcaagatggctattatggtttgtatcacgataaagtgattccattagatcgccgttct
gtctcggaaattattaaccgtggtggtacttttttaggttcggcacgttttccacaattt
aaagatattgaggttcgcaaacaagcggtcaagattttagcaaaatatgaaattgatgct
ttggtggtgattggcggtgacggatcttatatgggcgctaaattactcacggaagaattt
ggttatccgtgtataggcttgccgggcacaattgataatgatattgttggcactgattat
actattggttatcaaaccgctttacaaacggccgttgaggcaattgaccgtttacgcgat
acttctacctcacaccagcgtatttcgattgtagaaattatgggacgccattgtggtgat
ttaaccattagtgcagcattagccggtggttgtgaatatattattgtgccagaaaaaggt
ttagataaagaatcgcttattcatagtattgctgataatttccgcaaaggtaaacgtcac
gcaattattgctattacggaattaatgacagatgtgcatcaattggcaagagaattagaa
gaaaaatttggccatgaaacacgggctaccgtgttaggccatatacaacgagggggttca
ccttgtccatttgatcgtattttagcctcccgtatgggagtctatgcggttgatttatta
cgtcaaggttttggtggtcgttgtgtcggcattcaaaatgagcatttagtgcatcatgat
attattgatgcaattaataatatgcgacgtccatttaaacaggatatatttgaagcggct
agtaaattagcctaa

DBGET integrated database retrieval system