KEGG   Haemophilus ducreyi: HD0644Help
Entry
HD0644            CDS       T00135                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hdu  Haemophilus ducreyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hdu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506294..507139)
Genome map
AA seq 281 aa AA seqDB search
MQIHFKNYQKKDRLLDLTKPQIMGILNFTPDSFSDSGQFFSLDKALKQVEKMLNDGANII
DIGGESTRPNAQIISLAEELDRVIPLVEAARKRFDCLISVDSSKATVFEEAAKAGADILN
DIRALTEPQALTTAVKLALPVCLMHMQGNPQTMQQRPKYDDVLAEVSDFLNQRIFECITS
GIAKQHIILDPGFGFGKTVQHNYILLKHLKAFADSGFPVLAGLSRKSMIGAVTGKSVEQR
TAGSITAALLAVQHGARIIRVHDVAETADALKVWQAMQDCE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccacttcaaaaattatcaaaaaaaagaccgcttattagacttaactaagcca
caaattatgggcattttgaattttacgcccgattcattttctgattctggccaattcttc
tctcttgataaagcccttaaacaagtagaaaaaatgctaaatgacggagccaacattatt
gatatcggcggagaatcaacccgccccaacgcacaaattattagcctagcagaagagcta
gaccgcgttattccactagttgaagcggccagaaaacgttttgattgtttaatttcagtg
gatagctcaaaggccaccgtatttgaagaagccgcaaaggcaggggctgatatcttaaat
gatattcgcgccttaacagaaccacaggcattaacaaccgcagtcaaactagcgttaccc
gtttgtttaatgcatatgcaaggtaatccacaaactatgcaacagcgccccaaatatgat
gatgtgctagcagaagtcagcgattttttaaatcaacgcatttttgaatgcattacatca
ggcattgccaaacagcatattatacttgaccccggatttggctttggtaaaactgttcaa
cacaattatattctgctaaaacacctaaaagccttcgccgattcaggctttcctgtgctt
gctggtttatcgcgtaaatcaatgatcggcgccgtaacaggcaaaagcgttgaacaacgc
acagcaggatcaataaccgcagcattattagccgtacaacatggtgcacggattattcgt
gtacacgatgtagcagaaacagcagacgcattaaaagtttggcaagcaatgcaagattgt
gaataa

DBGET integrated database retrieval system