KEGG   Haemophilus ducreyi: HD0762Help
Entry
HD0762            CDS       T00135                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hdu  Haemophilus ducreyi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hdu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hdu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hdu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hdu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hdu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598103..598873
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTQQLIAELKTELAEITGCDVAIAPPVMYLSEAEIALAGQST
IRLGAQNVDINTQGAFTGDISTAMLQEFCAKYIIIGHSERRTYHAESDQFIAKKFAALKT
AGLTPVLCIGETEAENEAGQTQQVCARQIDAIINSLGVEAFNQAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRQHIAEKSQAVADQLIIQYGGSVNDTNAAELFSQPDIDGALVGGASLK
ATAFAEIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggcagtaaagcatttaca
caacaactaattgccgaattaaaaacagaattagctgaaataaccggttgtgatgtagca
attgcaccaccggtaatgtatttatcagaagcggaaatagctttagcagggcaatcgacc
atccgcctaggcgcacagaatgttgatataaatacccaaggagcctttacaggcgatatt
tccaccgcaatgttacaagagttttgtgcgaaatacattattatcggccattcagaacgc
cggacttaccacgcagaaagcgatcaatttatcgcaaaaaaattcgctgcattaaaaaca
gcaggattaacacccgtattatgtattggcgaaacagaagcagagaatgaagccggccaa
acacaacaagtgtgcgcacgccaaattgacgccataattaacagcttaggcgttgaagca
tttaatcaagccgttatcgcttatgaacccatctgggctatcggcacaggaaaatccgca
acgccagcccaagcccaagccgtgcatgcctttatccgccaacatatcgcagaaaaatcg
caagccgtagcagaccaactaattatccaatatggcggatccgtaaacgacaccaatgcc
gcagaactatttagccaacctgatattgacggtgcattagtgggaggcgcatccttaaaa
gcgaccgcatttgcagagatcgtaaaagcggctgaaaaagccaaagcataa

DBGET integrated database retrieval system