KEGG   Haemophilus ducreyi: HD0762Help
Entry
HD0762            CDS       T00135                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hdu  Haemophilus ducreyi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HD0762 (tpiA)
   01230 Biosynthesis of amino acids
    HD0762 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HD0762 (tpiA)
   00051 Fructose and mannose metabolism
    HD0762 (tpiA)
   00562 Inositol phosphate metabolism
    HD0762 (tpiA)
Enzymes [BR:hdu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HD0762 (tpiA)
Exosome [BR:hdu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HD0762 (tpiA)
  Exosomal proteins of bladder cancer cells
   HD0762 (tpiA)
  Exosomal proteins of melanoma cells
   HD0762 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598103..598873
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTQQLIAELKTELAEITGCDVAIAPPVMYLSEAEIALAGQST
IRLGAQNVDINTQGAFTGDISTAMLQEFCAKYIIIGHSERRTYHAESDQFIAKKFAALKT
AGLTPVLCIGETEAENEAGQTQQVCARQIDAIINSLGVEAFNQAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRQHIAEKSQAVADQLIIQYGGSVNDTNAAELFSQPDIDGALVGGASLK
ATAFAEIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggcagtaaagcatttaca
caacaactaattgccgaattaaaaacagaattagctgaaataaccggttgtgatgtagca
attgcaccaccggtaatgtatttatcagaagcggaaatagctttagcagggcaatcgacc
atccgcctaggcgcacagaatgttgatataaatacccaaggagcctttacaggcgatatt
tccaccgcaatgttacaagagttttgtgcgaaatacattattatcggccattcagaacgc
cggacttaccacgcagaaagcgatcaatttatcgcaaaaaaattcgctgcattaaaaaca
gcaggattaacacccgtattatgtattggcgaaacagaagcagagaatgaagccggccaa
acacaacaagtgtgcgcacgccaaattgacgccataattaacagcttaggcgttgaagca
tttaatcaagccgttatcgcttatgaacccatctgggctatcggcacaggaaaatccgca
acgccagcccaagcccaagccgtgcatgcctttatccgccaacatatcgcagaaaaatcg
caagccgtagcagaccaactaattatccaatatggcggatccgtaaacgacaccaatgcc
gcagaactatttagccaacctgatattgacggtgcattagtgggaggcgcatccttaaaa
gcgaccgcatttgcagagatcgtaaaagcggctgaaaaagccaaagcataa

DBGET integrated database retrieval system