KEGG   Haemophilus ducreyi: HD1334Help
Entry
HD1334            CDS       T00135                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hdu  Haemophilus ducreyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HD1334 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HD1334 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HD1334 (sucB)
Enzymes [BR:hdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HD1334 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1090888..1092099)
Genome map
AA seq 403 aa AA seqDB search
MSIEILTPVLPESVADATVATWHKNIGETVKRDEVLVEIETDKVVLEVPAPNDGLLTEII
QPTGSSVVPKQLLGKLSTIQAGDMAQITAKQPPQRQTTEPRTDTHNDIDSQGPSIRRLLA
EHNIEAHAIQGSGVDGRITREDIQQFLATQSSQQVASTDLTDSLNTIAYEDRSEKRVPMT
RLRKRIAERLLEAKNSTAMLTTFNEVNMQPIMQLRKQYGEKFEKQHGVRLGFMSFYIKAV
VEALKRYPEINASIDGEDVIYHNYFDISIAVSTPRGLVTPVIRDCDKLSMAEIEKAIKLF
ADKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPIAMNGEV
VIRPMMYLALSYDHRLIDGKESVGFLVSIRDLLEDPTRLLLEI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattctcacccccgtcctgcctgagtcagtcgctgatgcaacggttgca
acttggcataaaaacatcggcgaaaccgtcaaacgtgatgaagtattagtggaaattgaa
accgataaggtggtgttagaagtgcccgcgcctaatgacggcttattaactgaaattatc
caaccaaccggctcaagtgttgtgcccaaacaacttttaggcaaactttcaacgatccaa
gcgggcgatatggctcaaattactgcaaaacaaccgccacaacgccaaacgactgagcca
cgtacagatacacataatgatatcgactcacaaggcccatctatacgccgactattagct
gagcataatattgaagcacatgccattcaaggttcaggcgtagatggcagaattacacgt
gaagatatccaacaattcctagcaacacaatctagccagcaagtggcgtccacggattta
acggatagtctaaacacgattgcttacgaagatcgtagcgaaaaacgcgtgccaatgaca
cgcttacggaaacgaattgcagaacgtttactcgaggctaaaaacagcacagctatgctg
acaaccttcaacgaagtcaatatgcaaccgattatgcaattacgtaaacagtatggcgaa
aaatttgaaaaacaacacggcgtccgcttaggttttatgtctttctatattaaagcggta
gttgaagccttaaaacgttatcctgaaatcaacgcatcaattgacggcgaagacgtgatt
taccacaactattttgatattagcattgcggtttctacaccacgaggtttagtaaccccc
gttattcgtgactgcgacaagctatctatggcagaaattgaaaaagccatcaaactattt
gccgataaagggcgcgatggtaaattaaccgtagaagagctaactggtggcaacttcacc
attaccaacggcggtgtatttggttcactcatgtcaacaccgattatcaatccaccacaa
agtgcgattttaggtatgcatgctattaaagatcgccctattgcgatgaacggcgaggtc
gttatccgcccaatgatgtatttagcattatcttatgatcatcgcttaattgatggtaaa
gagtctgtcggctttttagtgagcatccgtgatttattagaagatccaacaagattactg
cttgagatctga

DBGET integrated database retrieval system