KEGG   Haemophilus ducreyi: HD1431Help
Entry
HD1431            CDS       T00135                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hdu  Haemophilus ducreyi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HD1431 (galU)
   00052 Galactose metabolism
    HD1431 (galU)
   00500 Starch and sucrose metabolism
    HD1431 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HD1431 (galU)
Enzymes [BR:hdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HD1431 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1172605..1173492
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVFVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSIVPNDVTLMHVRQGQAKGLGHAVLCGKAVVGK
EPFAVVLPDVILADFTANPKTENLAAMIKRFSETQCSQIMVAPVPQEDVSNYGIVDCATD
NIRAGETAKIAKMVEKPSIENAPSNLAIVGRYVFSATIWDLLERTPVGVGDEIQLTDAID
MLIEKETVEAFHMTGRAFDCGDKLGYMEAFVEYSLRHEKCGQQFQKIIKELAKSL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattattcctgttgcaggcttaggaacacgaatgcttccggctactaaagcc
attcctaaagaaatgttaactattgcagataaaccactcattcaatacattgtcaatgaa
tgtgttgcagccggtattaaagaaatcgtattcgtgacacactcatctaaaaatgcgatc
gaaaatcatttcgacacttcttttgaattggaaacaatgttggaaaaacgtgttaaacgc
caattgttagatgaagttcgttcaattgtaccgaatgatgttacgttaatgcatgttcgc
caaggacaagcaaaaggattagggcatgctgttttatgcggtaaagcggtcgtgggtaaa
gagccatttgcagttgttttaccggacgttattttggctgattttaccgctaaccctaaa
acagaaaatttggccgctatgattaaacgtttttcagaaacccaatgtagtcaaattatg
gttgcacccgtgccacaagaagatgttagcaattatggtatagttgattgtgcgacggat
aacattcgtgcaggagaaacagccaaaatcgctaaaatggttgaaaaaccatctattgag
aatgccccttctaatcttgccattgtaggacgctatgttttctctgcaactatttgggat
ctattagaacgtacgcctgtaggggtaggggatgaaattcaattaacggatgcgattgat
atgctgatcgaaaaagaaactgttgaagcattccatatgacagggcgtgcttttgattgt
ggtgataaattaggctatatggaggcttttgttgagtatagcttacgccacgaaaaatgc
ggtcaacaattccaaaaaatcattaaagaactagcgaaaagcttgtaa

DBGET integrated database retrieval system