KEGG   Haemophilus ducreyi: HD1758Help
Entry
HD1758            CDS       T00135                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hdu  Haemophilus ducreyi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hdu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HD1758 (ruvA)
Enzymes [BR:hdu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HD1758 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469533..1470138)
Genome map
AA seq 201 aa AA seqDB search
MIGRLYGKIIEKQPPEMVIDVQGIGYEVLLPMTSFYHLPQVGEEATIFTHLVVREDAHLL
FGFAQKQDRTLFRELIKTNGVGPKLALAILSAMSVVQFANAVENEELVKLTKIPGVGRKT
AERLLVELKGKFKGIAQTDFFVEHSHETMVATYEIDASEEARDALLALGYKLTDAEKMIK
KVHKSGATSEQLIRDALKASL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgtttatacggaaaaattattgagaaacagccccccgagatggttattgat
gtacagggcataggctatgaagttttattacctatgaccagtttttaccatttaccccaa
gtcggtgaagaggccactatttttactcatttagtcgtacgtgaagatgcgcatttatta
tttggttttgcccaaaagcaagatcgcaccttgtttcgtgaattaattaaaacgaatggt
gttgggcctaaattagcgcttgctattttatccgcaatgtctgttgtgcaatttgccaat
gcggttgagaacgaagaactggttaaattaactaaaattccaggtgttggacgtaagacc
gctgaacgattattggttgagttaaaaggcaagtttaaaggaatagcacaaacggatttc
tttgtagagcattcacacgaaacgatggttgccacctatgaaatagatgcttcagaagag
gcgcgtgatgctctccttgcattaggttataagttaaccgatgcagagaaaatgatcaaa
aaagtgcataaatctggtgcaaccagtgaacaactcattcgcgatgcactaaaagcatca
ctataa

DBGET integrated database retrieval system