KEGG   Helicobacter pylori F16: HPF16_0111Help
Entry
HPF16_0111        CDS       T01910                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hef  Helicobacter pylori F16
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF16_0111 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF16_0111 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPF16_0111 (thrC)
Enzymes [BR:hef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPF16_0111 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112426..113886)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKDKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFAQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAN
NLKVFGISGDFDDAQNALKNLLKDDDFNDALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLESLH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccactcgttctttgaaagacaaaaagattgattttattgaagcaata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcgcttg
ggtttagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgcccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctaac
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaatgcgctcaaaaac
cttttaaaagacgatgattttaacgacgctttaaaagcgcgccaattaaaattaagcgtg
gccaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgcttgaaaacaatccaa
gaagtttatgccgagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctattcttttg
tggctagaaagcctacattaa

DBGET integrated database retrieval system