KEGG   Helicobacter pylori F16: HPF16_0125Help
Entry
HPF16_0125        CDS       T01910                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hef  Helicobacter pylori F16
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hef00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
129606..130244
Genome map
AA seq 212 aa AA seqDB search
MISMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataagcatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcacgcattggcacgaatcaatttgtgatcaataaaagaaacgctgtttttgaccaattg
aatgaaaacaccttactggttttgcatgacaagattgattaccgctggaaagaagcgagc
ctggattcgcctattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagcttagcgtattccttgcgccacaaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaagtcgccatttttaaccccaaagattat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system