KEGG   Helicobacter pylori F16: HPF16_0125Help
Entry
HPF16_0125        CDS       T01910                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hef  Helicobacter pylori F16
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPF16_0125
Enzymes [BR:hef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPF16_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
129606..130244
Genome map
AA seq 212 aa AA seqDB search
MISMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataagcatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcacgcattggcacgaatcaatttgtgatcaataaaagaaacgctgtttttgaccaattg
aatgaaaacaccttactggttttgcatgacaagattgattaccgctggaaagaagcgagc
ctggattcgcctattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagcttagcgtattccttgcgccacaaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaagtcgccatttttaaccccaaagattat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactaggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system