KEGG   Helicobacter pylori F16: HPF16_0220Help
Entry
HPF16_0220        CDS       T01910                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hef  Helicobacter pylori F16
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hef01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hef00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224709..225860)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENGVKNLFLYRIFNPPKEHT
EEKHAKENVKPLHFCFAGHIDVVPPGNHWQSDPFKPIIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMVVVAEPTCEKVLGDS
IKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVHLDDGDEYFDPSKLV
ITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKSVPYTLELESSSSPFI
TASHSKLASVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLENLSEK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccatcacgcccaaagaa
tgcggtatttttgaatacattaaatcactttttcctacttttaaagctctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagagcataca
gaagaaaagcatgcaaaagaaaatgttaagcccttgcatttttgctttgcggggcatatt
gatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaacccattattaaagag
gggtttttatacggccgtggggcgcaagacatgaaagggggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaacccctttcatgctttctgttttactcacaagcgat
gaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaaaaagat
ttgctccctcacatggtggttgtggctgaacccacttgcgaaaaagtcctaggcgatagc
atcaaaatcggccgaagaggctctattaatggcaaactcattttaaaaggcgttcaaggg
catgtagcttacccgcaaaaatgccaaaaccccattgatacgctcgcttctgttttgccc
ttgatttcgggagtccatttagacgatggcgatgaatattttgacccttcaaaattggtt
atcaccaacttgcatgcagggttaggagcgaataatgtaacgcccgcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagaaagtttgaaagaatatttagaa
aaggttttaaaaagcgtgccttacactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttgccagcgttttaaaagaaaatattttaaagacatgccat
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattttttagcgctcat
ggcatagaagtggtggaatttggcgttattaatgacagaatccatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagagaattta
agcgagaaataa

DBGET integrated database retrieval system