KEGG   Helicobacter pylori F16: HPF16_0224Help
Entry
HPF16_0224        CDS       T01910                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hef  Helicobacter pylori F16
Pathway
hef00900  Terpenoid backbone biosynthesis
hef01100  Metabolic pathways
hef01110  Biosynthesis of secondary metabolites
hef01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF16_0224 (dxr)
Enzymes [BR:hef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPF16_0224 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: BAJ54821
UniProt: E6NCG1
Position
230304..231410
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVGIEALSCGKNIALINEQIKVFKPKKVAILDPNDVNAL
EPLGAEVFVGLEGIDAMIEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASTDMQLPISYAINPKLASLSASIKPLDLYALNAIKFEPISMERYILWRYKDLLLENP
KLGVVLNASNEVAIEKFLNKEIAFGGLIKTISQALESYAKTPFKLSNLDEVLALDKEVRE
RFGSVARM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtaggaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtagcgatcttagatcctaacgatgtgaatgcttta
gagcctttaggtgcggaagtgtttgtggggctagagggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggcgggattaagggcgagcttt
aaaagcttacaaactaacaaaaaactagccctagcgaataaagagagtttggtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgacagcgagcattttggtttgtgg
gcgttattgcaaaacaaggctttaaagcctaaatccttaatcattagcgcgagcgggggg
gctttcagggacacgcctttagaactcattcctattcaaaacgcgcaaaacgcactcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacttattggctttttggcgcgtctttaaagattgatgcactg
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctatcattgcg
catttggcaagcacggacatgcaattacccataagctatgccattaaccctaaattagct
tctttgagcgcgtctatcaagcccctagacttatacgctttaaacgcgattaaatttgaa
cccattagcatggagcgctatattttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcaagcaatgaggtggcgatagagaagtttttgaacaaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaaactctctaatttagatgaagtgctggcgttggataaggaagttagggag
cgttttggaagtgtagcgagaatgtag

DBGET integrated database retrieval system