KEGG   Helicobacter pylori F16: HPF16_0283Help
Entry
HPF16_0283        CDS       T01910                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hef  Helicobacter pylori F16
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF16_0283
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF16_0283
Enzymes [BR:hef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPF16_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290517..291077
Genome map
AA seq 186 aa AA seqDB search
MQEIGILKNLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVVVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQQNRK
KIVFLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttaaaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgcgtcgttgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattc
gcttggcgtttgggtttaagcgtgtttgtagaaacccacaagccagactatacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaacaaaatcgaaaa
aaaatagtttttttagattga

DBGET integrated database retrieval system