KEGG   Helicobacter pylori F16: HPF16_0369Help
Entry
HPF16_0369        CDS       T01910                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hef  Helicobacter pylori F16
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hef00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hef00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375615..376538
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLGLDEIKLLLKKASVYANDFNAVSLETKEKMQNKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQTSSASKGETLTDTFKNIHAMQPDAIITRHAFSSAPFKLA
EFSQCPLINAGSGVSAHPTQALLDLLTLYQHFGSLENLKGKKIAFIGDVKNSRVANSNIK
LLQRLGLEIMLCAPSSMLPSVSLKTTHNIEEAIEFADILMSLRTQTERHNAPIFASLKDY
GNAYCITQKRLEAHAKNKEIIILHPGPVHRDIDIESAVLEDKRSKVLEQVKNGVAMRMAV
LEFLLLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgacacttgctccaaactagcgatttaggcctagatgaaatcaag
cttttattaaaaaaagcgagcgtttatgcgaacgattttaacgccgtatctttagaaaca
aaagaaaaaatgcaaaataaaatcatcgtggctttattttttgaaaattccaccagaacg
gtgtctagttttgaaattgcaagcttgagattgggggcaaaaatcgtgaaattaaacatg
caaacaagctccgcttcaaagggtgaaactctaacagacacttttaaaaatatccatgcc
atgcagcctgatgctatcatcacacggcatgctttttcaagtgcgccttttaaattagcc
gaattttcacaatgccccttgattaacgcaggaagcggcgtaagcgctcatccgacccaa
gcgttattggacttgctcaccctttatcagcattttggcagtttagaaaatttaaaaggg
aaaaaaatcgctttcataggcgatgtgaaaaattccagagtggctaatagtaacattaaa
ttactccaaaggctagggcttgagatcatgctgtgcgctccaagctccatgctccctagt
gtttctttaaaaacgacgcacaacattgaagaagcgatagaatttgcagacattttaatg
agtttgaggacccaaaccgaacggcacaacgcacccatttttgcgagcttgaaagattat
ggcaacgcttattgcatcacccaaaaacgcctagaggctcacgctaaaaataaagagatc
attattctacacccaggcccggtgcatagggacattgatatagaaagcgcagtgttagaa
gataagcgatctaaagttttagagcaggtcaaaaacggcgtggcgatgcgtatggcggtg
ttggagtttttgctattagactga

DBGET integrated database retrieval system