KEGG   Helicobacter pylori F16: HPF16_0702Help
Entry
HPF16_0702        CDS       T01910                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hef  Helicobacter pylori F16
Pathway
hef00071  Fatty acid degradation
hef00072  Synthesis and degradation of ketone bodies
hef00280  Valine, leucine and isoleucine degradation
hef00310  Lysine degradation
hef00362  Benzoate degradation
hef00380  Tryptophan metabolism
hef00620  Pyruvate metabolism
hef00630  Glyoxylate and dicarboxylate metabolism
hef00640  Propanoate metabolism
hef00650  Butanoate metabolism
hef00900  Terpenoid backbone biosynthesis
hef01100  Metabolic pathways
hef01110  Biosynthesis of secondary metabolites
hef01120  Microbial metabolism in diverse environments
hef01130  Biosynthesis of antibiotics
hef01200  Carbon metabolism
hef01212  Fatty acid metabolism
hef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF16_0702 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPF16_0702 (thl)
   00640 Propanoate metabolism
    HPF16_0702 (thl)
   00650 Butanoate metabolism
    HPF16_0702 (thl)
  Lipid metabolism
   00071 Fatty acid degradation
    HPF16_0702 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPF16_0702 (thl)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPF16_0702 (thl)
   00310 Lysine degradation
    HPF16_0702 (thl)
   00380 Tryptophan metabolism
    HPF16_0702 (thl)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF16_0702 (thl)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPF16_0702 (thl)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPF16_0702 (thl)
Enzymes [BR:hef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPF16_0702 (thl)
Exosome [BR:hef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPF16_0702 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAJ55299
UniProt: E6NDT9
Position
711922..713097
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVVVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKTMAAIKGFGLGGCSPDIMGICPSIAIRNNLK
NVKMNLNNINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgcagtggggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtgttgtcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gccccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggattaatgatggcgcgagtgttatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattagaaacaatcttaaa
aatgtcaaaatgaatctcaataacatcaatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagaacttgaattaaatcctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcatggcgtgggttgcgcgtcattgtgtgtgggcggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system