KEGG   Helicobacter pylori F16: HPF16_0955Help
Entry
HPF16_0955        CDS       T01910                                 

Gene name
glyS
Definition
glycyl-tRNA synthetase subunit beta
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
hef  Helicobacter pylori F16
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hef00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1004595..1006697)
Genome map
AA seq 700 aa AA seqDB search
MHSDELLVEILVEELPAQALLNEYKEMPKKLHALFSKHALEVGNIEIFYTPRRLCLLVKD
FPLLTQETKEEFFGPPVKIACNHQDKTQGLNELGLGFYQKLGLKDYQHFQTAFKNNKEVL
YHAKIHAKEPTKDLIMPIVLEFLEGLNFGKSMRWGNVEKSFIRPIHNICVLFNGENFNDI
EVKEYGFKTKQATKAHRQEGFNFIQVDNPKAYFEVLEKNHVILDPKKRKAKILQEIKELE
TKHHIVVEIDRDLLDEVVAITEYPSALLGEFDKAFLKLPSEIITTSMKENQRYFAAFNQK
SQESPTLHNGFIVVSNAINKDKQKIITGNQKVLKARLSDAVFFYENDLKKPLDNAPLESV
VFVQGLGTLKDKMEREVIIAQYLTQKYASSLNMPLEKALELIGRAVRIAKADLLSEVVYE
FSELQGIMGYYYALKQNENELVALSVKEQYLPTSENAPLPSSVFSTIVALSLKLDSLFSF
FSVGKIPSGSKDPFALRRLSFGLLKIIAHYGLEFDLKADLKNLFEKVGVYQSFDLEILEK
FLLERFNNLIDCNPSIIRSVLNTNERDIVKIIQKVKALKRFLDDPKNAQKKELLFSAFKR
LANINKDRNPNESSEFFISLFKESQEHALFEAFNAIKTSAFESLDSKIEAYFGLHAPLEE
YFKSVLVMDKDIEIQKNRKNFLWGVYQSFLEIGDIKEIAI
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
ttgcattcagatgaattgttagtagagattttagttgaagaattgcccgctcaagcgtta
ttgaatgaatataaagaaatgcctaaaaaactccatgctctttttagtaagcacgcttta
gaagtgggaaatatagagattttttacacccctaggcgtttgtgtttgttggttaaagat
tttcctcttttaacccaagaaaccaaagaggaattttttgggcctcccgttaaaatcgca
tgcaatcatcaagataaaacgcaagggttgaacgagttaggtttagggttttatcaaaaa
ttagggttaaaagattaccagcatttccaaacagcgtttaaaaacaataaagaggtgctt
tatcacgctaaaatccatgcgaaagagcctacaaaagatttaatcatgcccattgtgtta
gagtttttagagggtttgaattttgggaagtctatgcgttggggcaatgtggaaaaaagc
tttatcagacccattcataatatttgcgtgttgtttaatggggaaaattttaacgatatt
gaagttaaagagtatggttttaaaaccaagcaagccacaaaagcacaccgacaagagggt
tttaattttattcaagtggataaccctaaagcgtattttgaagttttagaaaaaaaccat
gtcattttagaccctaaaaagcgcaaagctaaaattttacaagaaattaaagagctagaa
acaaagcatcatatcgtcgtagaaatagatagggatctattagatgaggtggtagcgatc
acggaataccctagtgcgcttttaggggagtttgacaaggcgtttttaaaattacccagt
gaaatcatcaccacttccatgaaagaaaaccaacgctattttgcagcctttaatcaaaaa
agccaagaaagcccaacattacacaacggctttattgtggtgagcaacgctatcaataaa
gacaagcaaaaaatcattacaggcaatcaaaaggttttaaaagcccgtttgagcgatgcg
gttttcttttatgaaaacgatctcaaaaagcctttagataacgcccctttagagagcgtg
gtttttgtgcaaggtttagggactttgaaagataaaatggagcgagaagtaatcatcgct
caatatttgacgcaaaaatatgcttcatctttaaacatgcctttagaaaaagcccttgaa
ttgattggccgagccgttagaatcgctaaggcggatttactcagtgaagtggtgtatgaa
tttagcgagcttcaagggatcatgggctattactacgctttaaaacaaaacgaaaacgag
ttagtcgccttgagtgtgaaagagcagtatttgcccacaagcgaaaacgctcccttgccc
tctagtgtttttagcacgatcgtggctttgagcttgaaattagacagcctgttttctttt
tttagcgtgggtaaaatccctagcggatctaaagatccttttgctttaaggcgcttgagt
tttgggctattgaaaattatcgcgcattatgggttagaatttgatttgaaagcggattta
aaaaatctctttgaaaaagtgggcgtttatcaaagctttgatttagaaattttagagaag
tttttactggagcgctttaataatttaatagattgtaacccctctattataaggagcgtg
ttaaacaccaacgagcgagacattgttaaaatcattcaaaaagtcaaagccttaaaacgc
tttttagacgatcccaagaacgctcaaaaaaaagagttgctttttagcgctttcaaacgc
ttagccaatatcaataaagacagaaaccctaacgaatcaagcgagttttttataagtctt
ttcaaagaatcgcaagagcatgccctttttgaagcgttcaatgcgatcaaaacaagcgct
tttgagagtttggatagcaaaatagaggcttattttggtttgcatgcacctttagaagaa
tattttaaaagcgtgctagtgatggataaagatatagaaatccaaaaaaatcgtaaaaat
ttcttgtggggcgtgtatcaaagtttcttagaaattggggatattaaagaaattgcgatt
tag

DBGET integrated database retrieval system