KEGG   Helicobacter pylori F16: HPF16_1339Help
Entry
HPF16_1339        CDS       T01910                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hef  Helicobacter pylori F16
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF16_1339
Enzymes [BR:hef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPF16_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403267..1404073
Genome map
AA seq 268 aa AA seqDB search
MMHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NQIFNWRLSLEELYSIGSLVGADTNFFISQYKSANATSYGEAIENFEEEPLENRLEIYAP
NHVFCSTKAIYQAYKPETCFSQAKEWLKKPSLEYLKTYDRNELNDLLKPALLTNQALRDI
ESELGKEWFFSGSGSTFFRLKPALKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttatcataagctcatttctcgcatgtgtttagtcaaagacaagctaaaggat
attatcagcgtcaaaagtgcgctttccttttcgctaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaat
ttctctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttg
aatcaaatttttaactggcgtttgagtttagaagagctttatagcataggatctttagtg
ggcgcggacaccaactttttcatctcgcaatacaaaagcgctaacgctacttcttatggc
gaagctattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgcca
aaccatgttttttgcagcaccaaagccatttatcaagcctataagcctgaaacttgtttt
tctcaagctaaagagtggcttaaaaagccgagtttagaatacctaaagacttatgataga
aacgaattaaacgatcttttaaaaccggctttactcactaaccaagccttaagagatata
gaaagcgaattaggcaaggagtggttttttagcgggagcgggagcacgttttttaggcta
aagcctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system