KEGG   Helicobacter pylori F16: HPF16_1357Help
Entry
HPF16_1357        CDS       T01910                                 

Gene name
yhjA
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hef  Helicobacter pylori F16
Brite
Enzymes [BR:hef01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPF16_1357 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421076..1422128
Genome map
AA seq 350 aa AA seqDB search
MKKSVLLGVCLAFSCVHALSDMDLIKKARESQLEPMPMGKALKEYQIKKTRDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
TKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPLGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccgttttattgggcgtttgcttggctttttcttgcgttcatgctttaagc
gatatggatttgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaaccagagatgtgggtattggcaccaaaaacagc
gagatcatgacccccgctcaagtggaattgggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgctgtaggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcaattttgggatgggagagttacgcactta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatccaaaagtg
gtggtagaaaaaatcaattccatgccaggttatgtcaaactctttagaaaagcttatggc
actaaagtcaaaattgattttaaattgatcgcagatagtattgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacaatgcagcctcttggggtagtcaaaccttataaattcgctaat
gtaggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccctaaagggtaaaaaacctaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system