KEGG   Helicobacter pylori Gambia94/24: HPGAM_00605Help
Entry
HPGAM_00605       CDS       T01917                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPGAM_00605
Enzymes [BR:heg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPGAM_00605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120957..121595
Genome map
AA seq 212 aa AA seqDB search
MLNMNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgaacacacacacaagaggcattgacagcgggctgatccattcgctacaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttcg
gcgcgcattggcgctaaccagtttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggtcttgcatgacaagatagattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagtttggcgtattccttgcgccataaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatcgccatttttaacccaaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaattgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgacgatccacgattgagcgtgtaa

DBGET integrated database retrieval system