KEGG   Helicobacter pylori Gambia94/24: HPGAM_00840Help
Entry
HPGAM_00840       CDS       T01917                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPGAM_00840
Enzymes [BR:heg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPGAM_00840
Exosome [BR:heg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPGAM_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(169680..170651)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETRLNINDFIAPLFVIESGSYIKNEISSMPGVYQMSIEPLL
KECEELVELGIKAVLLFGIPKHKDATGSHALNKDHIVAKATREIKQRFKDLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKALDKA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagggcgatgttaagagaa
acgcgtttaaatattaatgatttcatcgctcccttatttgtcatagaaagcggtagttat
attaaaaacgaaatcagctccatgcctggcgtgtatcaaatgagtatagagcctctttta
aaagaatgcgaagaattagtggagcttggtataaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagct
acgagagaaattaaacaacgatttaaggatctgatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgacaaa
acgctagagattttaaatcttcaaggacttattttagctgaaagcggcgtggatattcta
gccccaagcaacatgatggatggcaatgttttaagcttgagaaaagcgctggataaggcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttattacggg
ccttttagagatgtagccaattctgcgccgagttttggcgatcgcaagagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggcgcg
gatattttaatggtgaagccggctttggcgtatttagatattgttaaagagattagagat
cacactttgctccctttagcgctctataacgtgagtggggaatacgccatgctcaaactc
gcacaaaaacacaacctgatcaattatgaaagcgttttgttagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system