KEGG   Helicobacter pylori Gambia94/24: HPGAM_00990Help
Entry
HPGAM_00990       CDS       T01917                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00010  Glycolysis / Gluconeogenesis
heg00051  Fructose and mannose metabolism
heg01100  Metabolic pathways
heg01110  Biosynthesis of secondary metabolites
heg01120  Microbial metabolism in diverse environments
heg01130  Biosynthesis of antibiotics
heg01200  Carbon metabolism
heg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPGAM_00990 (tpiA)
   00051 Fructose and mannose metabolism
    HPGAM_00990 (tpiA)
   00562 Inositol phosphate metabolism
    HPGAM_00990 (tpiA)
Enzymes [BR:heg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPGAM_00990 (tpiA)
Exosome [BR:heg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPGAM_00990 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPGAM_00990 (tpiA)
  Exosomal proteins of melanoma cells
   HPGAM_00990 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU81048
UniProt: E8QK23
Position
199635..200339
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPVFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKGKNFKIVY
CIGEDLTTREKGFRAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaatttcaaatccgctatgcctgtttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttccaaacatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaagaaaaatttgatttttttaaaggtaaaaattttaaaattgtctat
tgtattggcgaagatttaacgaccagagaaaagggttttagggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcactaaaaaaagcgcgtctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaaccaaaaaacgcccttattgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system