KEGG   Helicobacter pylori Gambia94/24: HPGAM_01210Help
Entry
HPGAM_01210       CDS       T01917                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPGAM_01210
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPGAM_01210
Enzymes [BR:heg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPGAM_01210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(234508..235674)
Genome map
AA seq 388 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECGENGVKNLFLYRIFNPPKEHA
EKEHAKEKHVKENVKPLHFCFAGHIDVVPPGNNWQSDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLQFNPKTPFMLSVLLTSDEEGPGIFGTKLMLEKLKEKDLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGIQGHVAYPQKCQNPIDALASVLPLISGVHLDNGDECFD
PSKLVITNLHAGLGANNVTPGSVEIVFNARHSLKTTQESLKEYLEKVLKDLPYTLELESS
SSPFITASHSKLTSVLQENILKTCRTTPLLNTKGGTSDARFFSAHGIEVVEFGAINDRIH
AVDERVSLKELELLEKVFLGVLEGLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaaccctagagtgtggg
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagagcatgca
gaaaaagaacatgcaaaagaaaagcatgtaaaagaaaatgttaagcccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctgggaacaactggcaaagcgatccctttaag
cccatcattaaagaagggtttttatacggccgtggggcgcaagacatgaaggggggcgtg
ggggcgtttttgagcgcaagcttacaatttaaccctaaaacccctttcatgctttctgtt
ttactcacgagcgatgaagaagggccggggatttttggcactaagctcatgctagaaaaa
ctcaaagaaaaggatttgctgccccatatggcgattgtggctgaacccacttgcgaaaaa
gtcttaggcgatagcatcaaaattggccgaagaggctccattaatggcaaactcatttta
aaaggcattcaagggcatgtggcttacccgcaaaaatgccaaaaccctattgacgcgctc
gcttcggttttacccttaatttcaggagttcatttagacaatggcgatgagtgttttgac
ccttcaaaattagtcatcaccaacttgcacgcagggttaggggctaataatgtaactcca
gggagcgtagaaattgtctttaatgcgcgccattctttaaaaaccacccaagagagtttg
aaagaatatttagaaaaggttttgaaagatttgccttatactttagaattagaatcaagc
agttcgcctttcatcacggcttcccattcaaagcttaccagcgttttacaagaaaatatt
ttaaaaacatgccgcaccaccccccttttaaacaccaaaggcggcacgagcgatgcgcga
ttttttagcgctcatggcatagaagtggtggagtttggcgccattaatgacaggatccat
gccgttgatgaaagggtgagcttgaaggaattagagcttttggaaaaagtgtttttaggg
gttttggagggcttgagcgagaaatag

DBGET integrated database retrieval system