KEGG   Helicobacter pylori Gambia94/24: HPGAM_01230Help
Entry
HPGAM_01230       CDS       T01917                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:heg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240105..241211
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAAKFGVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNDL
EPFGAKVFVGLDGIDAMIEECVSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLDLIAIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSVIA
HLASADMKLPISYAINPKFASLNASIKPLDLYALSAIKFEPISLERYTLWRYKDLLLENP
KLGVVLNASNEVAMKKFLNQEIAFGGFIQIISQALESYAKTPFKLSSLDEVLELDKEVRE
RFGSVARV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctatcgggaaaaacgcccttaaaatcgcagcaaaa
tttggcgtagaaatagaagccttaagctgtgggaagaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgatcttagatcctaacgatttgaatgattta
gagccttttggcgcgaaagtgtttgtggggttagacggcattgatgcgatgatagaggag
tgcgtttccaatttagtccttaacgccattgtgggcgtagccggattgaaagcgagcttt
aaaagcttacaaaggaacaaaaaactagccctagcgaataaagagagcttagtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgatagcgagcattttggcttgtgg
gcgttgttgcaaaacaagactttaaagcctaaatctttaatcattagcgcgagtgggggg
gcttttagagacacgcccttagatcttatcgctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaattttagaaacctactggctttttggcgcgtctttaaagattgacgcgctg
attgaaagaagttctatcgtgcatgctttggtggaatttgaagacaactctgtcatcgcg
catttagcgagtgcggacatgaaactacccataagctatgccattaaccccaaattcgct
tcgttgaacgcttccatcaagcccttagatttatacgctttaagcgcgattaaatttgag
ccaatcagtttagagcgctacactttgtggcgttataaagatttgttgttggaaaatcca
aagcttggcgtggtgctgaatgcgagcaatgaagtggcgatgaagaagtttttgaatcaa
gaaatcgcctttggaggctttatccaaatcatttctcaagccttagaatcatacgctaaa
acgcctttcaaactctctagtttagatgaagtgctagaattagacaaagaagttagggag
cgttttggaagtgtagcgagagtgtag

DBGET integrated database retrieval system