KEGG   Helicobacter pylori Gambia94/24: HPGAM_01315Help
Entry
HPGAM_01315       CDS       T01917                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
heg  Helicobacter pylori Gambia94/24
Brite
Enzymes [BR:heg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPGAM_01315
Secretion system [BR:heg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPGAM_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256710..257507
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLIKVIEKQTNKKVRILETKPLKSNQD
LKIVVVEDPDTKYQIPLVVSKDGNLVIGLGGIFFSNNSEDVKLLTETNQKILALNTTQQN
SAKLNALFDGVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagcgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaagacaatttgattaaagtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagactaaacccttgaaatccaatcaggat
ttaaaaatcgtggtggtagaagatccggacactaaataccagatcccgcttgtggtgagt
aaggatggtaatttagtcatagggcttggtggtatcttttttagcaataatagcgaagac
gtgaagttgctcacagagaccaatcaaaaaatcctagcccttaacaccacccagcaaaat
agtgcgaaattgaacgctctttttgatggagtgccagctgattatgtgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cactgccaaaaagagctcactaagctcagagaccacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggttaattcagctaaaaaggcggctttaatccaagaagaa
atggcgaaggctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system